KEGG   Trichechus manatus latirostris (Florida manatee): 101348660Help
Entry
101348660         CDS       T05135                                 

Definition
(RefSeq) heat shock 70 kDa protein 1-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu03040  Spliceosome
tmu04010  MAPK signaling pathway
tmu04141  Protein processing in endoplasmic reticulum
tmu04144  Endocytosis
tmu04213  Longevity regulating pathway - multiple species
tmu04612  Antigen processing and presentation
tmu04915  Estrogen signaling pathway
tmu05134  Legionellosis
tmu05145  Toxoplasmosis
tmu05162  Measles
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    101348660
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101348660
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101348660
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101348660
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    101348660
  09152 Endocrine system
   04915 Estrogen signaling pathway
    101348660
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    101348660
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    101348660
  09172 Infectious disease: viral
   05162 Measles
    101348660
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101348660
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:tmu01009]
    101348660
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:tmu03041]
    101348660
   03009 Ribosome biogenesis [BR:tmu03009]
    101348660
   03110 Chaperones and folding catalysts [BR:tmu03110]
    101348660
   04131 Membrane trafficking [BR:tmu04131]
    101348660
   03051 Proteasome [BR:tmu03051]
    101348660
   03029 Mitochondrial biogenesis [BR:tmu03029]
    101348660
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tmu04147]
    101348660
Protein phosphatases and associated proteins [BR:tmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     101348660
Spliceosome [BR:tmu03041]
 Complex B
  Other components
   Prp19 complex
    101348660
 Complex C
   Prp19-CDC5 complex
    101348660
Ribosome biogenesis [BR:tmu03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    101348660
Chaperones and folding catalysts [BR:tmu03110]
 Heat shock proteins
  HSP70 / DNAK
   101348660
Membrane trafficking [BR:tmu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    101348660
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    101348660
Proteasome [BR:tmu03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    101348660
Mitochondrial biogenesis [BR:tmu03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    101348660
Exosome [BR:tmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   101348660
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Radial_spoke_3
Motif
Other DBs
NCBI-GeneID: 101348660
NCBI-ProteinID: XP_023581327
UniProt: A0A2Y9QHS0
Position
Unknown
AA seq 641 aa AA seqDB search
MAASKGMAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ
VAMNPQNTVFDAKRLIGRKFNDPVVQSDMKLWPFQVINDGGKPKVLVSYKGENKAFYPEE
ISSMVLTKMKETAEAFLGHSVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTA
AAIAYGLDKGGQGERHVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLV
SHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQANLEIDSLYEGIDFYTSIT
RARFEELCADLFRGTLEPVEKALRDAKMDKAKIHDIVLVGGSTRIPKVQRLLQEYFNGRD
LNKSINPDEAVAYGAAVQAAILMGDKSEKVQDLLLLDVAPLSLGLETAGGVMTVLIKRNS
TIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTRDNNLLGRFDLTGIPPAPRGVPQIEVTF
DIDANGILNVTAMDKSTGKANKITITNDKGRLSKEEIERMVLDAEKYKAEDEVQREKIAA
KNALESYAFNMKSSVSDEGLKGKISESDKKKILDKCNEVLSWLEANQLADKDEFDHKRKE
LEQVCNPVITKLYQGGCTGPACGTGYPSGRPATGPTIEEVD
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atggctgctagtaagggaatggccattggcatcgacctgggcaccacctactcgtgtgtg
ggggtgttccagcacggcaaggtggagatcatagccaacgaccagggcaaccgcaccacc
cccagttacgtggccttcactgacactgagcggctcattggggatgcggccaagaaccag
gtagccatgaatccccagaacactgtctttgatgccaagcgtttgataggaaggaaattt
aatgatcctgtggtgcaatcagatatgaaactttggccttttcaagtgatcaatgatggg
ggaaagcccaaggtgttggtgtcctacaaaggagaaaataaagctttctatcctgaggaa
atctcttctatggtcctgactaagatgaaggagactgctgaagcttttttgggccactct
gttaccaatgctgtgatcaccgtgccagcctatttcaatgattctcaacgccaggccacc
aaggatgcaggtgttattgcaggactcaatgtgctgagaatcatcaatgaacccacagct
gctgctattgcctatggtttagataaaggaggtcaaggagagcgacacgtcttgatcttc
gatctaggcggaggcacgtttgatgtgtccattctgactatagatgatgggatttttgag
gtgaaggccacagctggggacacccacctgggtggggaggattttgacaacaggctggtg
agccacttcgtggaggagttcaagaggaagcacaagaaggacatcagccagaacaagcga
gctgtgaggcggctgcgcactgcctgtgaaagggccaagaggaccctgtcgtccagcacc
caggccaacctggagattgactccctgtatgagggcatcgacttctacacatccattacc
agagctcggtttgaagagttgtgtgcagacctgtttaggggcaccttggagcctgtggag
aaggctttacgtgatgccaagatggataaggctaaaatccatgacattgttttggtaggg
ggctccactcgtatccccaaggtgcagaggctgctgcaggaatactttaatggtcgtgat
ctcaacaagagcatcaaccccgatgaggcagtagcctatggtgctgcagtacaggcagcc
attttgatgggtgacaagtctgaaaaggtacaggacctgcttttgttggatgtggctccc
ctgtccctaggtttggagacagccgggggcgtgatgactgttctgatcaagcgcaattcc
accatccccaccaagcagacacagatcttcaccacctactcagataaccagcccggggtg
ctgatccaggtgtatgagggtgagagggccatgacccgggacaacaatttgctagggcgc
tttgacctgactggaatccctcctgcacccaggggagttcctcagattgaagtgaccttt
gacatcgatgccaacggtattctcaatgtcacagccatggacaagagcacgggcaaggcc
aacaagatcaccatcaccaacgacaagggccgcctgagcaaggaggagattgagcgcatg
gttctggatgctgagaagtataaagctgaggatgaggtccagagggagaaaatcgctgca
aaaaatgccttagaatcctatgcttttaacatgaagagttctgtgagtgatgaaggcttg
aagggcaagattagtgagtctgataaaaagaaaatactggataaatgcaatgaagtcctc
tcatggctggaggccaatcaactggctgacaaagatgagtttgatcacaagagaaaagaa
ttggagcaggtgtgtaacccagtcattacaaaactctaccagggaggatgcacagggcct
gcctgtggaacagggtatccatctggaaggcctgccacaggccccaccattgaagaagta
gattaa

DBGET integrated database retrieval system