KEGG   Trichechus manatus latirostris (Florida manatee): 101350143Help
Entry
101350143         CDS       T05135                                 

Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type 1D
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu04020  Calcium signaling pathway
tmu04921  Oxytocin signaling pathway
tmu04925  Aldosterone synthesis and secretion
tmu05214  Glioma
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    101350143
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    101350143
   04925 Aldosterone synthesis and secretion
    101350143
 09160 Human Diseases
  09162 Cancer: specific types
   05214 Glioma
    101350143
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tmu01001]
    101350143
Enzymes [BR:tmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     101350143
Protein kinases [BR:tmu01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   101350143
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal Kdo RIO1 APH 5_nucleotid Tyrosinase
Motif
Other DBs
NCBI-GeneID: 101350143
NCBI-ProteinID: XP_004379739
UniProt: A0A2Y9DRE8
Position
Unknown
AA seq 384 aa AA seqDB search
MARENGESSSSWKKQAEDIKKIFEFKETLGTGAFSEVVLAEEKATGKLFAVKCIPKKALK
GKESSIENEIAVLRKIKHENIVALEDIYESPNHLYLVMQLVSGGELFDRIVEKGFYTEKD
ASTLIRQVLDAVYYLHRMGIVHRDLKPENLLYYSQDEESKIMISDFGLSKMEGKGDVMST
ACGTPGYVAPEVLAQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDSKLFEQILKAEYEF
DSPYWDDISDSAKDFIRNLMEKDPNKRYTCEQAARHPWIAGDTALNKNIHESVSAQIRKN
FAKSKWRQAFNATAVVRHMRKLHLGSSLDSSNASVSSGLSLASQKDCLASSTLCSFISSS
GVSGVGAERRPRPTTVTTVHTGSK
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggcccgggagaacggcgagagcagctcctcctggaaaaagcaagctgaagacataaag
aaaattttcgagttcaaggagaccctcggaactggggcattttctgaggtggttttagcg
gaagagaaggcaactgggaaactctttgccgtcaagtgcatccctaagaaggcgctgaag
ggcaaagaaagcagcatagagaatgagatcgccgtgctgagaaagattaagcatgaaaac
atcgttgccctggaagatatttatgaaagcccaaatcacttgtacttggtcatgcagctt
gtatctggtggagagctgtttgatcggatagtggagaagggattttacacagagaaagat
gccagtaccctgatccgccaggtcttggatgctgtgtactatctccacaggatgggcatc
gtccacagggacctcaagcccgaaaatctcctgtactacagtcaagatgaggagtcgaaa
ataatgatcagtgactttggattgtcaaaaatggagggcaaaggagatgtgatgtccaca
gcctgtggaaccccaggctatgttgctcctgaggtcctcgcccagaaaccttacagcaaa
gctgttgactgctggtccatcggggtgattgcctacatcttgctctgtggctaccctcct
ttttatgatgaaaatgactccaaactctttgaacagatcctcaaggcagaatatgagttt
gactctccctactgggacgacatctctgactcagctaaagacttcattcggaatttgatg
gagaaagatccaaataaaagatacacatgtgagcaggcagctcggcacccatggattgct
ggtgacacagccctcaacaaaaacatccacgaatctgtcagtgcccagattcggaagaac
ttcgcaaaaagcaaatggagacaagcattcaatgccacggccgtcgtgagacatatgaga
aaactacatcttggcagcagcctggacagttcaaatgcaagtgtatcgagcggcctcagc
ttggccagccaaaaagattgcctggcatcctccaccctctgtagtttcatttcctcctcg
ggggtctcaggagttggagctgaacggagaccaaggcccaccactgtgacgacggtgcat
actggcagcaagtga

DBGET integrated database retrieval system