KEGG   Trichechus manatus latirostris (Florida manatee): 101350181Help
Entry
101350181         CDS       T05135                                 

Definition
(RefSeq) leukotriene B4 receptor 1
  KO
K04296  leukotriene B4 receptor 1
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101350181
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:tmu04030]
    101350181
G protein-coupled receptors [BR:tmu04030]
 Rhodopsin family
  Lipid
   Leukotriene
    101350181
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srsx 7tm_4 Myc_target_1
Motif
Other DBs
NCBI-GeneID: 101350181
NCBI-ProteinID: XP_023581163
UniProt: A0A2Y9QPN3
Position
Unknown
AA seq 350 aa AA seqDB search
MAMNTTSPAAAISPSVFIRPLAIILLSVALAVGLPGNGFVVWSILAKMRKRSVTALLVLN
LALADLAVLLTAPFFLSFLARGTWVFQLIGCRLCFYICGVSMYASILLITAMSLDRSLAV
ACPFLSQKLRTKAMAGRVLAGIWVASVLLATPVLVYRTVALEKNNRSLVCLEKYPTESHR
AFHLLFETITGFLLPFLAVVASYSDLGRRLQARHFRRSRRTSRLVVVIILAFAAFWLPYH
VVNVAEAGRALAGLVPGSGPAGMRLILVRKVLIALAFLSSSVNPVLYACAGGSLLRSAGV
GFVAKLLEGTGSEVSSARRGGTLGQTMRGAPTFPKPGPAENLTASCNPLD
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atggccatgaacactacctctcctgcagcagcaatctcaccgagtgtcttcatccgtccg
ctggccatcattttactgtcagtggcactggctgtggggcttcctggcaacggattcgta
gtgtggagcatcctggcaaaaatgcggaagcgctctgtcactgccctgctggtgctgaac
ttagccttggcggacttggccgtattgctcactgccccctttttcctctccttcctggcc
cgaggcacctgggtctttcaactgattggctgccgcctctgcttctatatctgtggggtc
agtatgtatgctagcatcctgcttatcacggccatgagtctggaccgctcgctggcagtg
gcctgccccttcttgtcccagaagctgcgcaccaaggcgatggctggtcgggtgctggca
ggcatctgggtggcgtccgtgctgctggccacgcccgtcttagtgtaccgcaccgtggcc
ttggaaaagaacaacaggagcctggtctgcttagagaagtaccccacggaaagccacagg
gccttccatctgctttttgagaccatcacgggcttcctgctgcccttcctggccgtggtg
gccagctactccgaccttgggcgcaggctgcaggcccggcacttccgccgcagccgccgc
accagccgcctggtggtggtcatcatcctggccttcgcagccttttggttgccctaccac
gtggtgaacgtggccgaggcgggccgcgcgctggccggcctggtccccgggtccgggcct
gcggggatgcggctgatcctggtccgcaaggtgctcatcgcgctcgccttcttgagcagc
agcgtgaaccccgtgctatatgcttgcgccggcggcagcctgctgcgctcggccggcgtg
ggcttcgtggccaagctgctggagggcacgggctctgaggtgtccagtgctcgccgcggg
ggcaccctgggccagaccatgaggggcgcccccacctttcccaagcctggccccgctgag
aacctcactgcctcctgcaaccctcttgactaa

DBGET integrated database retrieval system