KEGG   Trichechus manatus latirostris (Florida manatee): 101350225Help
Entry
101350225         CDS       T05135                                 

Definition
(RefSeq) pseudouridine-5'-phosphatase
  KO
K17623  pseudouridine 5'-phosphatase [EC:3.1.3.96]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:tmu01009]
    101350225
Enzymes [BR:tmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.96  pseudouridine 5'-phosphatase
     101350225
Protein phosphatases and associated proteins [BR:tmu01009]
 HAD phosphatases
  Other HAD phosphatases
   101350225
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_6 Hydrolase_like HAD Put_Phosphatase
Motif
Other DBs
NCBI-GeneID: 101350225
NCBI-ProteinID: XP_004385239
UniProt: A0A2Y9E307
Position
Unknown
AA seq 231 aa AA seqDB search
MAAPATPPRPVTHLLFDMDGLLLDTERLYSMVFQEICDRYGKKYSWDVKSLVMGKKALDA
AEIIIQVLQLPMSKEELVEESQMKLRQVFSQASLLPGVEKLIHHLRKHDIPCAVATSSGT
ASFEEKTSQHKEFFSLFHHVVLGDDPEVRSGKPSPDIFLACAKRFSPTPPLDKCLVFEDA
PNGVEAALAAGMQVVMVPDANLNRDLTRNATMLLSSLQDFQPELFGLPPYE
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgcccgcgaccccgccgcggcccgtcacccacctgctttttgacatggacggc
ctccttctggacactgaacggctgtattcaatggtgtttcaagaaatatgcgatcgctat
gggaagaaatactcctgggatgtgaagtccctggtcatgggtaaaaaggcgttggatgcc
gcggagattataatacaagtcctgcagctcccaatgtccaaggaggagctggtggaggag
agccagatgaagctgagacaagtgttctcccaggcctctctgctgccaggtgttgaaaaa
ctgatccatcacctgcggaaacacgacataccctgtgccgttgccaccagctcggggacg
gcgtcctttgaagagaagacgagccaacacaaggagttcttcagcctgttccatcacgtc
gtgctgggggatgacccagaagtgcggagtggcaagccgagccctgacatattcctggcc
tgcgcaaagaggttttctcccactcctccactggacaagtgcctcgtgttcgaagatgct
cccaacggggtggaggcggccctggcggcgggcatgcaggtggtcatggtcccggatgcg
aacctgaaccgggacctgaccaggaatgccaccatgctgctcagctccctccaggatttc
cagcctgagctgtttggtctgccgccctacgagtga

DBGET integrated database retrieval system