KEGG   Trichechus manatus latirostris (Florida manatee): 101350381Help
Entry
101350381         CDS       T05135                                 

Definition
(RefSeq) band 3 anion transport protein
  KO
K06573  solute carrier family 4 (anion exchanger), member 1
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu04966  Collecting duct acid secretion
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    101350381
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tmu02000]
    101350381
   04147 Exosome [BR:tmu04147]
    101350381
   04090 CD molecules [BR:tmu04090]
    101350381
Transporters [BR:tmu02000]
 Solute carrier family (SLC)
  SLC4: Bicarbonate transporter
   101350381
Exosome [BR:tmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101350381
CD molecules [BR:tmu04090]
 Proteins
  101350381
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HCO3_cotransp Band_3_cyto
Motif
Other DBs
NCBI-GeneID: 101350381
NCBI-ProteinID: XP_004374360
UniProt: A0A2Y9DHE0
Position
Unknown
AA seq 916 aa AA seqDB search
MGDLQDEYEQVMGENPELEDYEDPGVLEEYQVEEPAAAFTEPTATDYHTTWHPHIHEVYV
ELQELVMDETNREPHWMEAARWMRVEENLGEDGAWGRPHLSYLTFWSLLELQRAFAKGTV
LLDLPETSLPGVANQLLDRFIYDEQVRPQDRDELLRALLLKHSHAEDLKALGSLKPMVLT
HSGDPLEPLLPQQPSLETQLFCGKEDRGTEEQLPSGILEKIPPDSEATLVLVGYAAFLER
PVLGFVRLQEAAMLEEAVKLPVPVRFLFVLLGPEKPRINYTQLGRAAATLMSERVFRIDA
YLAQSREDLVSSLEDLLDCSLVLPPTDASSEQALLSLVPVQKELLRRRYQRRTAEPDPSF
LKGLDLNGGPGEPEDPLQRTGQFFGGLVRDIRRRYTHYLSDITDALSPQVLAAVIFIYFA
ALSPAITFGGLLGEKTKNLMGVSELLISTAVQGIIFTLLGAQPLLVVGFSGPLLVFEEAF
YSFCEENKLEYIVGRVWIGFWLILLVVLVVAFEGSFLVRFISRYTQEIFSFLISLIFIYE
TFSKLIKIFQEHPLQKYYEANVTMDPKPLRPLPNTALLSLVLMAGTFFFAMMLRKFKNSS
YFPGKLRRVIGDFGVPISILIMVMVDFFIEDTYTQKLKVPKGLMVSNSTARGWVIHPLGL
YSTFPIWMMFASALPALLVFILIFLESQITTLIISKPERKMVKGSGFHLDLLLVMGMGGV
AALFGMPWLSATTVRSVTHANALTVMGKAGTPGAAAQIQEVKEQRISGLLVSVLVGLSIF
MEPILSRIPLAVLFGIFLYMGVTSLSGIQLFDRILLLFKPPKYHPDVPYVKRVKTWRMHL
FTGIQIFCLVALWVVKSTPASLALPFVLILTVPLRRFLLPLIFWNLELQCLDADDAKVTF
DEQEGRDEYDEVPMPV
NT seq 2751 nt NT seq  +upstreamnt  +downstreamnt
atgggggatttgcaggatgagtatgaacaggtgatgggggagaacccggagctggaggac
tatgaagacccaggtgttctcgaggagtaccaggtggaggaaccagcagctgccttcaca
gagccaacagctacagactaccacaccacatggcacccacacatccatgaggtctacgtg
gagctgcaggaactggtgatggacgagacgaacagggagcctcattggatggaggcagca
cgctggatgcgagtggaggaaaacctgggggaggacggggcctggggccgcccacacctg
tcttatctcaccttctggagcctcttggagctgcagagagcctttgccaagggcaccgtc
ctcctggatctgccggagacatccctgcccggggtggccaaccagctgctggacaggttt
atctatgatgagcaggtccggcctcaggaccgagatgagctgcttcgggccctgctgctc
aaacacagccatgcagaagacctgaaggccctgggaagtttgaagcccatggttctgaca
cactctggggaccccttagagcctctgctcccccaacagccctcactggagacacagctc
ttctgtgggaaggaagacaggggcacagaagagcaattgccatctggaattctggaaaag
attcccccagactcagaggccaccctggtgctagtgggctacgctgccttcctagagcgg
cctgtgctgggcttcgtgcggctgcaggaggccgcaatgctggaggaggccgtgaagctg
cccgtgcctgtgcgcttcctcttcgtgttgctgggccccgagaagccccgcattaactac
acccagctgggccgggctgctgccaccctcatgtcagagagggtgttccgcatagatgcg
tacctagcccagagccgggaggacctggtgagctccctggaagacttgttggattgcagc
ctggtgctgccccccacggacgcctcctccgagcaggccctgctcagcctggtgcccgtg
cagaaggagctcctacggaggcgctaccagcgcaggactgccgagccagacccaagcttc
ctcaagggcctagacctgaatgggggtccaggggaacctgaagaccctctgcagcggaca
ggccagttctttgggggcctggtgagggacatccggcgccgctacacccactacctgagt
gacatcacggacgctctcagtccccaggtcctggctgctgtcattttcatctactttgcc
gccctgtcaccagccatcacctttggtggcctcctgggagaaaagaccaagaacctgatg
ggggtgtcggaactgctcatctccactgcggtgcagggcattatcttcaccctactgggg
gctcagcctctgcttgtggttggcttctcaggacccctgcttgtgttcgaggaagccttc
tactcgttctgtgaagagaacaagctggagtacatcgtgggccgcgtgtggattggcttc
tggctcatcctgctggtggtgctagtggtggcctttgagggcagcttcctggttcgcttc
atctcccgctacacccaggagatcttctccttcctcatctccctcatcttcatctatgag
accttctccaagctgatcaagatattccaggaacacccattgcagaagtactacgaagcc
aatgtgacgatggaccccaaacccctgcgccccctgcccaatacagccctcctctcgctc
gtgcttatggctggcaccttcttctttgccatgatgctacgcaagttcaagaacagctcc
tacttccctggaaagctgcgcagagtcatcggagactttggtgtccccatctccatctta
atcatggtcatggtggatttcttcatcgaggacacctacacccagaaactcaaagtgccc
aaaggcctcatggtatccaactctacggcccggggctgggtcattcacccacttggcttg
tattccacatttcccatctggatgatgttcgcctctgccctgcctgccctgctggtcttc
atcctcatcttccttgagtctcagatcaccacgctgattatcagcaagccagagcgcaag
atggtcaagggctctggcttccacctggacctgctgctggtcatgggcatgggcggagtg
gctgccctctttgggatgccctggctgagtgccaccaccgtgcgttctgtcacccatgcc
aacgccctcactgtcatgggcaaggccggaacccctggggccgcggcccagatccaggag
gtcaaggagcagcggatcagcgggctcttggtctctgtgctcgtgggcctgtccatcttc
atggagcccatcctgtcccgcattcccctggctgtgctgtttggcatcttcctctacatg
ggggtcacatccctcagtggcatccagctcttcgatcgtatcttgctcctgtttaagcca
cccaagtaccacccagatgtgccctacgtcaagcgggtgaagacctggcgcatgcacctg
ttcacgggcatccagatcttctgcctggtagcgctgtgggtggtgaagtccacacctgcc
tcactggccctgccctttgtcctcatcctcactgtgcccctgcggcgctttctactgcca
ctcatcttctggaacctggagctccagtgtctggatgccgatgatgccaaggtgaccttt
gacgagcaggaaggtcgggatgagtatgatgaggtgcccatgcctgtgtga

DBGET integrated database retrieval system