KEGG   Trichechus manatus latirostris (Florida manatee): 101350438
Entry
101350438         CDS       T05135                                 

Definition
(RefSeq) adenylate cyclase type 4
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu00230  Purine metabolism
tmu01100  Metabolic pathways
tmu01522  Endocrine resistance
tmu04015  Rap1 signaling pathway
tmu04020  Calcium signaling pathway
tmu04022  cGMP-PKG signaling pathway
tmu04024  cAMP signaling pathway
tmu04062  Chemokine signaling pathway
tmu04072  Phospholipase D signaling pathway
tmu04114  Oocyte meiosis
tmu04211  Longevity regulating pathway
tmu04213  Longevity regulating pathway - multiple species
tmu04261  Adrenergic signaling in cardiomyocytes
tmu04270  Vascular smooth muscle contraction
tmu04371  Apelin signaling pathway
tmu04540  Gap junction
tmu04611  Platelet activation
tmu04713  Circadian entrainment
tmu04714  Thermogenesis
tmu04723  Retrograde endocannabinoid signaling
tmu04724  Glutamatergic synapse
tmu04725  Cholinergic synapse
tmu04727  GABAergic synapse
tmu04742  Taste transduction
tmu04750  Inflammatory mediator regulation of TRP channels
tmu04911  Insulin secretion
tmu04912  GnRH signaling pathway
tmu04913  Ovarian steroidogenesis
tmu04914  Progesterone-mediated oocyte maturation
tmu04915  Estrogen signaling pathway
tmu04916  Melanogenesis
tmu04918  Thyroid hormone synthesis
tmu04921  Oxytocin signaling pathway
tmu04923  Regulation of lipolysis in adipocytes
tmu04925  Aldosterone synthesis and secretion
tmu04926  Relaxin signaling pathway
tmu04927  Cortisol synthesis and secretion
tmu04928  Parathyroid hormone synthesis, secretion and action
tmu04934  Cushing syndrome
tmu04935  Growth hormone synthesis, secretion and action
tmu04970  Salivary secretion
tmu04971  Gastric acid secretion
tmu04972  Pancreatic secretion
tmu04976  Bile secretion
tmu05032  Morphine addiction
tmu05163  Human cytomegalovirus infection
tmu05166  Human T-cell leukemia virus 1 infection
tmu05200  Pathways in cancer
tmu05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    101350438
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101350438
   04371 Apelin signaling pathway
    101350438
   04020 Calcium signaling pathway
    101350438
   04072 Phospholipase D signaling pathway
    101350438
   04024 cAMP signaling pathway
    101350438
   04022 cGMP-PKG signaling pathway
    101350438
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101350438
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101350438
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101350438
   04062 Chemokine signaling pathway
    101350438
  09152 Endocrine system
   04911 Insulin secretion
    101350438
   04923 Regulation of lipolysis in adipocytes
    101350438
   04912 GnRH signaling pathway
    101350438
   04913 Ovarian steroidogenesis
    101350438
   04915 Estrogen signaling pathway
    101350438
   04914 Progesterone-mediated oocyte maturation
    101350438
   04921 Oxytocin signaling pathway
    101350438
   04926 Relaxin signaling pathway
    101350438
   04935 Growth hormone synthesis, secretion and action
    101350438
   04918 Thyroid hormone synthesis
    101350438
   04928 Parathyroid hormone synthesis, secretion and action
    101350438
   04916 Melanogenesis
    101350438
   04925 Aldosterone synthesis and secretion
    101350438
   04927 Cortisol synthesis and secretion
    101350438
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101350438
   04270 Vascular smooth muscle contraction
    101350438
  09154 Digestive system
   04970 Salivary secretion
    101350438
   04971 Gastric acid secretion
    101350438
   04972 Pancreatic secretion
    101350438
   04976 Bile secretion
    101350438
  09156 Nervous system
   04724 Glutamatergic synapse
    101350438
   04727 GABAergic synapse
    101350438
   04725 Cholinergic synapse
    101350438
   04723 Retrograde endocannabinoid signaling
    101350438
  09157 Sensory system
   04742 Taste transduction
    101350438
   04750 Inflammatory mediator regulation of TRP channels
    101350438
  09149 Aging
   04211 Longevity regulating pathway
    101350438
   04213 Longevity regulating pathway - multiple species
    101350438
  09159 Environmental adaptation
   04713 Circadian entrainment
    101350438
   04714 Thermogenesis
    101350438
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101350438
  09165 Substance dependence
   05032 Morphine addiction
    101350438
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    101350438
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101350438
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101350438
   05163 Human cytomegalovirus infection
    101350438
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101350438
Enzymes [BR:tmu01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     101350438
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N CD52
Other DBs
NCBI-GeneID: 101350438
NCBI-ProteinID: XP_004390586
UniProt: A0A2Y9EB92
Position
Unknown
AA seq 1076 aa
MARLFRPRPPPSEDLFYETYYSLSQQYPLLLLLLVIVLCALVALLAVAWASGRELASDSG
FLTTVLCALGGFSLLLGLASREQRLQRWTRPLSGLVWAALLALGHGFLFTGGVVSAWDQV
SFFLFVIFTVYTMLPLGMRDAAAAGLASSLSHLLVLGLYLGPQPDSWPALLPQLVANAVL
FLSGNVAGAYHKALMERALRATFREALSSLHSRRRLDTEKKHQEHLLLSILPAYLAREMK
AEIMARLQAGRGSRPESTNNFHSLYVKRHRGVSVLYADIVGFTRLASECSPKELVLMLNE
LFGKFDQIAKEHECMRIKILGDCYYCVSGLPLSLPDHAINCVRMGLDMCRAIRKLRAATG
VDINMRVGVHSGSVLCGVIGLQKWQYDVWSHDVTLANHMEAGGVPGRVHITGATLALLAG
AYAVEDAAMEHRDPYLRELGEPTYLVIDPRAEEDEKGIAGGLLSSLEGPKMRPSLLMTRY
LESWGAAKPFAHLSHIDSPVSTSTPLPEKALASFSPQWSLDRSHTPWGLDDELDTGDAKF
FQVIEQLNSQKQWKQSKDFNPLTLYFREKEMEKEYRLSALPAFKYYAACTFLVFLSNFII
QMLVTNRPPALAITYSITFLLFLLLLFVCFSEHLTRCVLKGPKMLHWLPALSGLVATWPG
LRVALGTATILLVFVMAITSLFFLPASSNCPFRTANVSSMAFNLSWELPGSLPLISVPYS
MHCCVLGFLSCSLFLHMSFELKLLLLLLWLAASCSLFLHSHAWLSDCLIARLYMGLLDSR
PGVLKEPKLMGTISFFIFFFTLLVLARQNEYYCRLDFLWKKKLRQEREETETMENLTRLL
LENVLPAHVAPQFIGQNRRNEDLYHQSYECVCVLFASVPDFKEFYSESNINHEGLECLRL
LNEIIADFDELLSKPKFSGVEKIKTISSTYMAATGLNATSGQDAQQDAERSCSHLGTMVE
FAVALGSKLDVINKHSFNNFRLRVGLNHGPVVAGVIGAQKPQYDIWGNTVNVASRMESTG
VLGKIQVTEETAQALKSLGYTCYRRGVIKVKGKGQLCTYFLNTDLMRTGPPSATLG
NT seq 3231 nt   +upstreamnt  +downstreamnt
atggcccgcctcttcagacctcggccgccccccagcgaagacctcttctacgagacctac
tacagcctaagccagcagtacccgctgctgctactgctgctggtgatcgtactctgcgcg
ctggtggcgctgctcgcggtcgcctgggccagcggcagggagctggcctcagactcgggc
ttcctgaccactgtgctgtgcgcactgggaggcttctcgctgctgctggggctggcttcc
cgcgagcagcgactgcagcgctggacgcgtcccctgtccggcctagtgtgggccgcgctg
ctcgcgctaggccacggcttcctgttcaccgggggcgtggtcagtgcttgggaccaggtg
tccttcttcctctttgtcatcttcacggtgtacaccatgttgcccctgggtatgcgggac
gccgctgccgcgggcctcgcctcatcactctcgcatctgcttgtccttggactgtacctt
gggccgcagccggactcatggcccgcgctgctgccccagctggtggcaaacgcggtgctg
ttcctgtccgggaacgtggcgggagcgtaccacaaggcgctgatggagcgcgcgctgcgc
gccaccttccgagaggcgctcagctccctacactcgcgccggcggctggacaccgagaaa
aagcatcaggaacaccttctcttgtccatccttcctgcctacctggcccgagaaatgaag
gcagagatcatggcacggctgcaggctggacgggggtcacggccggaaagcaccaacaac
ttccacagcctctatgtcaagaggcatcggggagtcagcgtgctgtatgcggacattgtg
ggcttcacgcggctggctagcgaatgttcccccaaggagctggtgctcatgctcaatgaa
ctctttggcaagttcgaccagatcgccaaggagcatgagtgcatgcggatcaagatcctg
ggagactgttactactgtgtctctgggttgcccctctccctgccagaccatgccatcaat
tgcgtgcgtatggggctggacatgtgccgggcgatcaggaaacttcgggcagccactggc
gtggacatcaacatgcgtgtgggtgtgcactcaggtagtgtgctctgtggagtcatcggc
ttgcagaagtggcagtatgatgtctggtcccatgatgtcaccctggccaaccacatggag
gcaggcggtgtgccaggacgagtgcacatcacaggggcgacactggccctactggcaggg
gcttatgctgtggaggatgcagccatggaacaccgagacccataccttcgggagctaggg
gagcctacctacctggtcatcgatccccgggccgaggaggatgagaagggcattgcagga
gggttgttgtcctctctggaaggccccaagatgcgtccatcactgctgatgacccgctat
ctggagtcctggggtgcagccaagccttttgcccacctaagccacatagacagccctgtg
tccacctctacccctctcccggagaaggccctggcttccttcagcccccagtggagcctg
gaccggagccataccccctggggactagatgatgaactagacaccggggatgccaagttc
ttccaggtcatcgaacagctcaactctcagaaacagtggaagcagtcaaaggatttcaat
ccactgacactgtacttcagagagaaggagatggagaaggagtaccgactctctgcactc
cccgccttcaaatactatgcagcctgcacgttccttgtttttctctccaatttcatcatc
cagatgctggtgacaaacaggcccccagctctggccatcacctatagcatcaccttcctc
ctcttcctcctccttctcttcgtctgcttctcagaacatctgacgaggtgtgtcctgaaa
ggccccaagatgctgcactggctgcctgcactgtctggcctggtggccacatggccgggc
ctacgagttgccctgggcaccgccaccatcctcctagtcttcgtcatggcgattaccagc
ctgttcttcctaccagcatcatccaactgccctttccgaaccgctaatgtgtcctccatg
gctttcaacctctcctgggagctccctgggtccctgcctctcatcagtgtcccgtactcc
atgcactgctgcgtgctgggtttcctctcctgctccctcttcctgcacatgagctttgaa
ttgaagctgctgctgctcctgctgtggctggcagcctcctgctccctcttcctgcactcc
cacgcctggctgtctgactgcctcatcgcccgcctctatatgggcctcttggactccaga
ccaggggtgctgaaggagcccaaactgatgggaaccatctccttcttcatcttcttcttc
accctcctcgtcctggctcggcagaatgagtattactgccgcctggacttcctgtggaag
aagaagctgaggcaggagagagaagagacagagacgatggagaacctgactcggctgctc
ttggagaatgtgctccctgcacacgtggccccccagttcattggccaaaacagacgcaat
gaggatctctaccaccagtcctacgagtgtgtttgtgtcctcttcgcctcagtcccagac
ttcaaggagttttactctgaatccaacattaaccatgaggggctggagtgtctgcgactg
ctcaatgagataattgctgattttgatgagctgctctccaagcccaagttcagtggggtg
gaaaaaatcaaaaccatcagcagcacctacatggcagccacaggtttaaatgccacctct
ggacaggacgcacaacaggatgctgaacgaagttgcagccaccttggcaccatggtggaa
tttgcggtggctctggggtctaaactggatgtcatcaacaagcattcattcaacaacttc
cgcctgcgtgtcgggttgaaccacggacccgtagtggctggtgtgattggagcccaaaag
ccacaatatgacatctggggcaacacggtgaacgtggccagccgcatggagagtacaggg
gtcttgggcaagatccaagtgactgaggagacagcccaggccctgaagtccctgggctat
acctgctacaggcggggtgtcatcaaagtcaaaggcaaagggcagctctgcacctacttc
ctgaacacagacttgatgcgcactggacccccctcagccaccctaggctga

DBGET integrated database retrieval system