KEGG   Trichechus manatus latirostris (Florida manatee): 101350573Help
Entry
101350573         CDS       T05135                                 

Definition
(RefSeq) probable glutathione peroxidase 8 isoform X1
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu00480  Glutathione metabolism
tmu00590  Arachidonic acid metabolism
tmu01100  Metabolic pathways
tmu04918  Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    101350573
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    101350573
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    101350573
Enzymes [BR:tmu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     101350573
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-GeneID: 101350573
NCBI-ProteinID: XP_004380523
UniProt: A0A2Y9DTY9
Position
Unknown
AA seq 209 aa AA seqDB search
MEPLTTYPLKCSGPKAKVFAVFLSMVLCTVLLFLLQLKFLKPRINSFYNFEVKDVKGRTV
SLEKFKGKVSLVVNVASDCKLTDRNYLALQELHKEFGPFHFSVLAFPCNQFGDSEPRPSK
EVESFARNNYGVTFPIFHKIKILGSEAEPAFRFLVDSSKKEPRWNFWKYLVNPEGQVVKF
WRPEEPIEAIRPDIAALVRQMIIKKKEDL
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atggagcctcttacgacttatcctttaaaatgttcggggcccaaagcaaaagtatttgca
gtttttttgtctatggttctgtgcacagtattgctatttcttctacaactaaaattccta
aaacctagaatcaacagcttttataactttgaagtgaaggatgtaaaagggagaactgtt
tctctggaaaagtttaaaggaaaagtttcactagttgtaaacgtggctagtgactgcaaa
ctcacagacagaaattacttagcactgcaggaactgcacaaagaatttggaccattccac
ttcagcgtcttggcttttccgtgcaatcagtttggagactcggagccacgcccaagcaag
gaagtagaatcttttgcaagaaataactacggagtaacattccccatcttccacaagatt
aagattctaggatctgaagcagaacctgcatttagatttcttgttgattcttcaaagaag
gaaccgagatggaatttttggaagtatctggtcaaccctgagggtcaagttgtgaagttc
tggaggccagaggagcccattgaagccatcaggcctgacatagcagctctggttagacaa
atgatcataaagaagaaagaggatctatga

DBGET integrated database retrieval system