KEGG   Trichechus manatus latirostris (Florida manatee): 101350664
Entry
101350664         CDS       T05135                                 

Definition
(RefSeq) MDS1 and EVI1 complex locus protein EVI1 isoform X2
  KO
K04462  ecotropic virus integration site 1 protein
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu04010  MAPK signaling pathway
tmu05200  Pathways in cancer
tmu05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101350664
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101350664
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    101350664
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tmu03000]
    101350664
Transcription factors [BR:tmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    101350664
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_6 zf-C2H2_jaz zf-H2C2_5 zf-BED zf-C2H2_11 zf-C2H2_8 PyrI_C
Other DBs
NCBI-GeneID: 101350664
NCBI-ProteinID: XP_004383495
UniProt: A0A2Y9DZQ2
Position
Unknown
AA seq 1049 aa
MKSEDYPHETMAPDIHEERQYRCEDCDQLFESKAELADHQKFPCSTPHSAFSMVEEEFRQ
QLESESDLREIHAIQECKECDQVFPDLQSLEKHMLSHTEEREYKCDQCPKAFNWKSNLIR
HQMSHDSGKHYECENCAKQVFTDPSNLQRHIRSQHVGARAHACPECGKTFATSSGLKQHK
HIHSSVKPFICEVCHKSYTQFSNLCRHKRMHADCRTQIKCKDCGQMFSTTSSLNKHRRFC
EGKNHFAAGGFFGQGISLPGTPAMDKTSMVNMSHANPGLADYFGANRHPAGLTFPTAPGF
SFSFPGLFPSGLYHRPPLIPASSPVKGLSSTEQTNKSQSPLMTHPQILPATQDILKALSK
HPPVGDNKPVELQPERSSEERPLEKISDQSESSDLDDVSTPSGSDLETTSGSDLESDIES
DKEKFKENGKMFKDKVSPLQNLASINNKKEYSNHSIFSPSLEEQTAVSGAVNDSIKAIAS
IAEKYFGSTGLVGLQDKKVGALPYPSMFPLPFFPAFSQSMYPFPDRELRSLPLKMEPQSP
SEVKKLQKGRSESPFDLTTKRKDEKLLTPVPSKPPATPATSQDQPLDLSMGSRSRASGTK
LTEPRKNHVFGEKKGSNVEPRPASDGSLQHARPTPFFMDPIYRVEKRKLTDPLEALKEKY
LRPSPGFLFHPQFQLPDQRTWMSAIENMAEKLESFSALKPEASELLQSVPSMFNFRAPPN
ALPENLLRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRH
VRNIHNKEKPFKCHLCDRCFGQQTNLDRHLKKHENGNMSGTATSSPHSELESTGAILDDK
EDAYFTEIRNFIGNSNQSPRNTEERMNGSHCKDEKALVTSQNSDLLDDEEVEDEVLLDEE
DEDNDITGKTGKESLTSNLHEGNAEDDYEETSALEMSCKTSPVRYKEEEYKTGLSALDHI
RHFTDSLKMRKMEDNQYTEAELSSFSTSHVPEELKQPLHRKSKSQAYAMMLSLSEKESLH
STSHSSSNVWHSMARAAAESSAIQSISHV
NT seq 3150 nt   +upstreamnt  +downstreamnt
atgaagagtgaagactatccccatgaaactatggccccggatatccacgaagaacgacaa
tatcgctgtgaggactgtgaccagctctttgaatctaaagctgaactagcggaccaccag
aagttcccatgcagtactcctcactcagcattttcaatggtggaagaggaatttcgacaa
caactcgaaagcgagagtgatctccgggagatacatgcaatccaggagtgtaaggaatgt
gaccaagttttccccgatttgcaaagcctggagaaacacatgttgtcacataccgaagag
agggaatacaagtgtgatcagtgtcccaaggcatttaactggaagtccaatttaattcgc
caccagatgtcacatgacagtggaaagcactatgaatgtgaaaactgtgccaagcaggtt
ttcacggaccctagcaaccttcagcggcacatccgctctcagcatgtcggtgcccgggcc
cacgcttgcccggagtgtggcaaaacgtttgccacttcatcgggcctcaaacaacacaag
cacatccacagcagtgtgaagccctttatctgtgaggtctgccataaatcctatactcag
ttttcaaacctttgtcgtcataagcgcatgcatgctgattgcagaacccaaatcaagtgc
aaagactgtggacaaatgttcagcactacgtcttccttaaataaacacaggaggttttgt
gagggcaagaaccattttgcggcaggtggattttttggccaaggcatttcacttcctgga
accccagctatggataaaacgtccatggttaatatgagtcatgccaacccgggcctggct
gactattttggtgccaataggcatcctgctggtcttacctttccaacagctcctggattt
tcttttagcttccctggtctgtttccttccggcttgtaccacaggcctcctttgatacct
gctagttctcctgttaaaggactatcaagtactgaacagacaaacaaaagtcaaagtccc
ctcatgacacatcctcagatactgccagctacacaggatattttgaaggcactatctaaa
cacccacctgtaggggacaataagccagtggagctccagcccgagaggtcctctgaagag
aggccccttgagaaaatcagtgaccagtcagagagtagtgaccttgatgatgtcagtacg
ccaagtggcagtgacctggaaacaacctcgggctctgatctggaaagtgacattgaaagt
gataaagagaaatttaaagaaaatggtaaaatgttcaaagacaaagtaagccctcttcag
aatctggcttcaataaataataagaaagaatacagcaatcattccattttttcaccatct
ttagaggagcaaactgcggtgtcaggagctgtgaatgattctataaaggctattgcttct
attgctgaaaaatactttggttcaacaggactggtggggctgcaagacaaaaaagttgga
gctttaccttacccttccatgtttcccctcccattttttccagcattctctcaatcaatg
tacccatttcctgatagagagttgcgatcgttacctttgaaaatggaaccccaatcacca
agtgaagtaaagaaactgcagaagggaaggtctgagtctccctttgatctcaccactaag
agaaaggatgagaagctcttgactccagtgccctccaagcctccagcaacgcctgccaca
agccaagaccagcccctggatctaagtatgggcagtaggagtagagccagtgggacaaag
ctgactgagcctcgaaaaaaccatgtgtttggagaaaaaaaaggaagcaacgtagaacca
agaccagcatcagatggctccttgcagcatgctagacccactcctttctttatggaccct
atttacagagtagagaaaagaaagctaactgacccacttgaagctttaaaagagaaatac
ttgagaccttctccaggattcttgtttcacccacaattccaactgcctgatcagagaact
tggatgtcggctattgaaaacatggcggagaagctagagagctttagtgccctgaaacct
gaagcaagtgagcttctacagtcagtcccctccatgttcaacttcagagcgcctcccaac
gccctgccagagaacctcctgcgcaagggaaaagaacgctatacttgcagatactgtggc
aagatttttccgagatctgcaaacctaacacggcacttgagaacccacacaggagagcag
ccttacagatgcaaatactgtgacagatcgtttagcatatcttctaacttgcagcggcat
gttcggaacatccacaataaggagaagccatttaagtgtcacttatgtgataggtgtttt
gggcaacaaaccaacctagacagacacttaaagaagcacgagaatggaaacatgtctggt
acggcaacatcatcccctcattctgaactggaaagtacaggcgcgattctcgatgacaaa
gaagatgcttactttacagaaattcggaatttcatcggaaatagcaaccagtcacccagg
aacacagaagaaaggatgaatggcagtcattgtaaggatgaaaaggctttggtgaccagt
caaaattcagatttattggatgacgaagaagtagaagacgaggtgttgttagatgaggag
gatgaagacaatgatattactgggaaaacaggaaaggaatcattgacaagtaatttacat
gaaggaaacgctgaggatgactatgaggaaaccagtgccctggagatgagttgcaagacc
tccccagtgagatataaagaggaagaatataaaactggactttctgctctagatcatata
aggcatttcacagatagcctcaaaatgaggaaaatggaagataatcaatatactgaagct
gagctgtcttcttttagtacgtcccatgtgccggaggaacttaaacagccgttacacaga
aagtccaaatcacaggcatatgctatgatgttgtcattgtccgaaaaggagtccctccat
tctacatcccacagttcttccaacgtgtggcacagtatggcaagggctgcagcggaatcc
agtgccatccagtccataagccacgtatga

DBGET integrated database retrieval system