KEGG   Trichechus manatus latirostris (Florida manatee): 101352431
Entry
101352431         CDS       T05135                                 

Definition
(RefSeq) A-kinase anchor protein 5
  KO
K16522  A-kinase anchor protein 5
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:tmu01009]
    101352431
Protein phosphatases and associated proteins [BR:tmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     101352431
SSDB
Motif
Pfam: WSK
Other DBs
NCBI-GeneID: 101352431
NCBI-ProteinID: XP_004371005
UniProt: A0A2Y9DBK0
Position
Unknown
AA seq 425 aa
MKECSVKMETTVSEIQVENKDEKTAAEVSPQDERQEEKGSTLCFKRRKKAAKALKPKAGS
EATDEARAFDQPQPLGGAWASFKRLVTRRKRSDSSKEQKRFEAKVQPEINAEDAGLSKKK
SRLKIPCIKFSRSEKRSSHSKIIEDSDCSIQVQGEAGSLDTKTQTQLTDQTTKARSIQDL
RKGVSQTPEIGEANVSNSITSPAEKVVSVELGLVTGHSAIQTETLILEKHIETIQEKQGV
QHEQANPPETSETDHQLPVVSDVPLPPAIPDQQIVEEASNSILEGGPNWKGHESREIVAK
ESKRKDTEVCTGESDTKENEISVEKPKSEESKRMEPIAIIITDTEISEFDMEKSKNVPKQ
FLISIENEQVGVFANDSGFEGRTSEYETLLIETASSLVKNAIQLSIEQLVNEMVSDDNKI
NNLLQ
NT seq 1278 nt   +upstreamnt  +downstreamnt
atgaaagagtgtagtgtaaaaatggagaccacagtttctgaaatccaagtagaaaacaag
gatgagaagacagcagcagaagttagtcctcaggacgagaggcaagaggaaaaaggctcc
acgctctgcttcaagagaaggaagaaagcagccaaagcgctgaagcccaaagctggctct
gaagccaccgatgaagcaagagcttttgatcagccacagcccctaggaggggcctgggcc
tcattcaaacgtcttgtaacacgaaggaaaaggtcagattcttcaaaggagcaaaagcgc
tttgaggctaaagtgcaacctgaaataaatgctgaggatgctggtctttccaagaaaaaa
tccagacttaaaattccctgcataaaattctcaagaagtgagaaaagaagtagtcattcc
aaaattatagaagactcagactgcagcatccaagtgcagggagaggctggaagtttggat
acaaaaactcagactcaattgactgaccagacaacaaaggccaggtcgattcaggatctc
cggaaaggtgtctcacagacacctgagatcggtgaagcgaatgtgagcaacagcataact
tctcctgcagagaaagtggtttcagtagaacttggattagttactgggcattctgctatt
cagacagaaactctaattcttgaaaaacatattgaaacgatccaggaaaaacaaggtgtc
cagcatgagcaagcaaatccacctgaaacttcagaaacagaccatcagctaccagtggtt
tctgatgttcctctcccaccggcaatcccagatcaacaaattgtagaagaagccagtaac
agtatcctagaaggtggaccaaattggaaaggccatgaaagtagagagattgtagctaaa
gagagtaagcgtaaagataccgaagtgtgtactggtgaatcagatactaaagaaaatgag
atcagtgtggagaaacccaaatcagaagaaagcaaaaggatggagccaattgctattatt
attacagacactgaaatcagtgaatttgatatggagaaatctaaaaatgtccctaagcaa
tttttaatttcaattgaaaatgagcaagtaggggtttttgccaatgatagtggttttgag
ggcagaacttcagaatacgaaacactgttaatagaaacagcttcttctctcgtcaagaat
gctatccagttgtctatagaacagctagttaatgaaatggtctctgatgataataaaata
aacaatcttctacagtga

DBGET integrated database retrieval system