KEGG   Trichechus manatus latirostris (Florida manatee): 101353066Help
Entry
101353066         CDS       T05135                                 

Definition
(RefSeq) cytosolic phospholipase A2 delta
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu00564  Glycerophospholipid metabolism
tmu00565  Ether lipid metabolism
tmu00590  Arachidonic acid metabolism
tmu00591  Linoleic acid metabolism
tmu00592  alpha-Linolenic acid metabolism
tmu01100  Metabolic pathways
tmu04010  MAPK signaling pathway
tmu04014  Ras signaling pathway
tmu04072  Phospholipase D signaling pathway
tmu04217  Necroptosis
tmu04270  Vascular smooth muscle contraction
tmu04370  VEGF signaling pathway
tmu04611  Platelet activation
tmu04664  Fc epsilon RI signaling pathway
tmu04666  Fc gamma R-mediated phagocytosis
tmu04724  Glutamatergic synapse
tmu04726  Serotonergic synapse
tmu04730  Long-term depression
tmu04750  Inflammatory mediator regulation of TRP channels
tmu04912  GnRH signaling pathway
tmu04913  Ovarian steroidogenesis
tmu04921  Oxytocin signaling pathway
tmu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    101353066
   00565 Ether lipid metabolism
    101353066
   00590 Arachidonic acid metabolism
    101353066
   00591 Linoleic acid metabolism
    101353066
   00592 alpha-Linolenic acid metabolism
    101353066
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101353066
   04010 MAPK signaling pathway
    101353066
   04370 VEGF signaling pathway
    101353066
   04072 Phospholipase D signaling pathway
    101353066
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101353066
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101353066
   04664 Fc epsilon RI signaling pathway
    101353066
   04666 Fc gamma R-mediated phagocytosis
    101353066
  09152 Endocrine system
   04912 GnRH signaling pathway
    101353066
   04913 Ovarian steroidogenesis
    101353066
   04921 Oxytocin signaling pathway
    101353066
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101353066
  09156 Nervous system
   04724 Glutamatergic synapse
    101353066
   04726 Serotonergic synapse
    101353066
   04730 Long-term depression
    101353066
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101353066
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    101353066
Enzymes [BR:tmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     101353066
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: cPLA2_C2 PLA2_B C2
Motif
Other DBs
NCBI-GeneID: 101353066
NCBI-ProteinID: XP_004380790
UniProt: A0A2Y9DTA8
Position
Unknown
AA seq 818 aa AA seqDB search
MESLSAGESPGHPHQGEASPCWQLTVKVLEARNLPWADLLSEADSYVILQLLTAPGTKFK
TKTVTNSNNPVWNETFTFRIQSQVKNVLELSIYDEDFVKKDDFFFKFLYDVSEVLPGKLL
QKTFSWSPQVGGEVELDVEFLVEKTLDHPENLTTNSVLVARELSCLNASLDCTGSTAVAS
DQDKLELVVKGSYEDTQTMTLGTASALRFHYMAAQETELSGRLRSSTSNGWNSDNSAEHL
TVPLQSLTMGKMVTVDLPAPNAPGVRLQLKAESCPKELAVRLGFDLCAEEQAFLSRRKQV
VAKALQQALQLEGDLQEDEVPVVGIMATGGGARAMTSLYGHLLALQKLGLLDCVTYFSGT
SGSTWAMAHLYGDPEWSQQDLEGPILHAREHMAKSKLETFSPESLRSYLQGLKVRAEQGY
PTTFVDLWALVLENMLHGQEVHQTLSGQRAALQRGQNPLPLYLSLNVKQNHLETLDFKEW
VEYSPYEVGFLKYGAFVPSELLGSDFFMGQLMRKIPESRICFLEAIWSNIVSVNLLDLWH
GLTSSGEAWKQYLKDKMRNTEKEPPACSETSSYLEASWLQPGTALAQAFKGFLENRPLHQ
CSPNFLHGLQLHQDYYSQKDFSTWADCQLDCTPGQLTVQEPQLCLVDTGYFINTSCPSMF
RPGRRLDLILSFDYSLSSPFEVLQQTELYCRAQGLPFPCVELSAQDLHQPRECYLFSDPD
CPKAPALLHFPLVNASFKDHSAPGVRRSPAELQAGQVDLNKATSPYSLFNMTYKEEDFDD
LLRLSDYNVRNSQDTILQALRTALKHHASGIRPPGVQT
NT seq 2457 nt NT seq  +upstreamnt  +downstreamnt
atggagagcctgtcagctggggagtcacctggccatcctcaccagggtgaggcctctccc
tgctggcagctcaccgtcaaggtcctggaggcacggaacctgccctgggctgacctgttg
agcgaggctgactcgtatgtgatcctgcagctgctgactgcacctggaacaaagtttaag
accaagaccgtcaccaactccaacaaccctgtatggaatgagaccttcaccttcagaatc
cagagtcaggtcaagaatgttctggagctgagcatctatgatgaggattttgttaaaaag
gatgatttcttcttcaagtttctctatgatgtctcagaagtcctgcctggcaagctgctt
cagaagaccttctcctggagtcctcaggtgggtggggaagtggagctagatgtagagttc
ctggtggagaaaacgttggaccacccagaaaacctcaccaccaacagcgtccttgtggcc
cgggagctgtcgtgcctgaacgcgagtctggactgcacagggagcacggccgtggcctca
gatcaggacaaactggagctggtggttaaggggtcatatgaggacacgcagacaatgact
ctgggcacagcctctgccttgcgcttccactacatggcagcccaggagacagagctgagc
gggcgcctgcggagctccacaagcaatggctggaactcagacaactcagctgagcacctc
actgtgcccctgcagtccttgaccatggggaagatggtgaccgttgatcttcctgcccca
aatgccccaggagtgaggcttcagctcaaggcagagagctgccccaaggagctggctgtg
cggctgggtttcgacctgtgtgcagaggagcaggccttcctgagcaggaggaagcaggtg
gtggccaaggctctgcagcaggccctgcagctggagggcgacctgcaggaggacgaggtc
cctgtcgtgggcatcatggccaccggagggggtgcccgggccatgacctcactctacggc
cacctgttggccctgcagaagctgggtctcctggactgtgtgacctatttcagtggcacc
tcaggctctacatgggcaatggcccacctgtatggggaccctgagtggtcacagcaggac
ctcgagggacccatcctacatgcccgggagcacatggccaagagcaagctggagaccttc
tccccagagtccctgaggagctacctgcaggggctgaaggtgcgggctgagcagggctac
cctaccacctttgtggacctgtgggccctagtgctggagaacatgctgcatggccaggag
gtgcatcagacgctgtcgggacagagggctgcactgcagcggggccagaaccctctgccg
ctctacctgagcctcaacgtgaaacagaaccatctggagaccctcgacttcaaggagtgg
gttgagtactccccctacgaggttgggttcctgaagtatggggccttcgtcccctctgag
ctcttgggctctgacttcttcatggggcagctgatgaggaagatccctgagtcccggatc
tgcttcttggaagctatctggagcaacattgtctccgtgaacttgctggatctctggcat
ggcctcaccagctctggggaagcctggaaacagtacctcaaggacaagatgaggaacaca
gagaaggagccccctgcctgctcagagacctcctcatacctagaggcctcgtggctgcag
cctggaacggcgctggcccaggccttcaagggcttcctggaaaacaggccgctccaccag
tgcagccccaacttcctccacggcctccagctgcaccaggactactacagccagaaagac
ttctctacctgggcagactgccagctagactgcacccccggccagctgaccgtccaggag
ccccagctctgcctggtggacaccggatactttatcaacaccagctgcccctccatgttc
cgaccaggccgtaggctagacctcatcctctcctttgactactccttgtcctcacccttt
gaggtgctgcagcagactgagctgtactgccgggcccaggggctgcccttcccctgtgtg
gagctgagcgctcaggacctccatcagccccgggagtgctacctcttctcagaccctgac
tgccccaaggctcctgccctgctgcacttcccgctggtcaacgcctccttcaaggaccac
tcggcccctggtgtccggcgcagccctgcagaactccaagctggccaagtggatctcaac
aaggccacctcaccctattccctgttcaacatgacgtacaaggaggaagactttgacgac
ctgctgcgtctcagtgactacaacgtgcgtaacagccaggacaccatcctgcaggccttg
aggactgccctgaagcaccatgcctcagggatccggcctccaggggtgcagacatga

DBGET integrated database retrieval system