KEGG   Trichechus manatus latirostris (Florida manatee): 101353457Help
Entry
101353457         CDS       T05135                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1 isoform X2
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu00010  Glycolysis / Gluconeogenesis
tmu00562  Inositol phosphate metabolism
tmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101353457
   00562 Inositol phosphate metabolism
    101353457
Enzymes [BR:tmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     101353457
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     101353457
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 DUF4708
Motif
Other DBs
NCBI-GeneID: 101353457
NCBI-ProteinID: XP_004369956
UniProt: A0A2Y9D9E8
Position
Unknown
AA seq 485 aa AA seqDB search
MPRGPGRFLRAPVAPAAALAAALLSSLARCSLLESGDPVASALSPYFGTKTRYEDVNPGL
LPNPEAPWRDPELLEGTCTPVQLVAVIRHGTRYPTAKQIRKLRQLHELLQARGPWGGRAS
ATSGRDVGAVLADRPLWYADWMDGQLVEKGRQDMRQLALRLASLFPTLFCRENFGRLRLV
TSSKHRCVDSGVAFLQGLWQHYNPGLTPPDVADMECGPPRINDKLMRFFDNCKKFLTEVE
RNATALYHVEAFKTGPEMQDILKKVAATLQVPINDLNADLIQVAFFTCSFDLAIKGIKSP
WCDVFDIDDAKVLEYLNDLKQYWKRGYGYTINSRSSCILFEDIFQHLDKAVEQKQRSQPI
SSPVILQFGHAETLLPLLSLMGYFKDREPLTAYNYKEQMHRKFRSGHIVPYASNLIFLLY
HCENAKTPKEEFQVQMLLNEKVLPFAHSQETVSLYEDLKNHYKGVLQSCHAIDECKLLKT
SSWLA
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgcggccccggccgcttcctccgggcccccgtagcgcccgccgcggccctggct
gcggcgctgctttcgtcgctggcgcgctgctccctcctggagtcgggggacccggtggct
tcggcgctcagcccctactttggcaccaagacccgctacgaggacgtcaaccccgggctg
cttccgaaccccgaggcgccctggagggacccagagctgctggagggcacatgtacgcca
gtgcagctggttgccgtcatccgccatggcacccgctaccccacagccaagcagatacgc
aagctgcggcagttgcacgagttgctacaggcccgcgggccgtggggtggcagggctagc
gctactagcggccgcgacgtgggcgctgtgctggccgacaggccgctgtggtacgcagac
tggatggacgggcagctggtggagaaagggcggcaggacatgcgacagctggcgctgcgc
ctagcctcgctcttcccgaccctcttctgccgtgagaatttcggccgcttgcggctcgtc
accagctccaagcaccgctgcgtggacagcggcgtcgcctttctgcagggactatggcag
cactacaaccctggcctgacgccgcccgacgtcgcagacatggaatgtggacctccaagg
attaatgataaactgatgaggttctttgataattgcaagaagtttttaactgaagtggaa
aggaatgctacagctctttaccatgtagaagccttcaaaactggaccagaaatgcaggac
attttaaaaaaagttgcagctactttacaagtgccaataaatgatttaaatgcagattta
attcaggtagcttttttcacctgttcatttgacctggcaattaaaggcattaagtctcct
tggtgtgatgtttttgacatagatgatgcaaaggttttagagtatttaaatgatctgaaa
caatattggaaaagaggatatggttatactattaatagtcgatccagctgcatcctgttt
gaggatatctttcagcacttggacaaagcagttgaacagaaacaaaggtctcagccaatt
tcttctccagtaatcctccagtttggtcatgcagagacccttcttccactgctttcactc
atgggctacttcaaagacagagagcccctaactgcttacaattacaaggaacaaatgcat
cggaagttccgaagtggtcatattgtgccctatgcctcgaacctgatatttctgctttac
cattgtgaaaatgctaagactcctaaggaagaattccaagtgcagatgttattgaatgaa
aaggtgttaccctttgctcactcacaagaaactgtttctttgtatgaggatctgaagaac
cattacaagggcgtccttcagagttgtcatgccattgacgaatgtaaactactaaagaca
tcatcctggctggcttaa

DBGET integrated database retrieval system