KEGG   Trichechus manatus latirostris (Florida manatee): 101354164Help
Entry
101354164         CDS       T05135                                 

Definition
(RefSeq) nucleoside diphosphate kinase 3
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu00230  Purine metabolism
tmu00240  Pyrimidine metabolism
tmu00983  Drug metabolism - other enzymes
tmu01100  Metabolic pathways
Module
tmu_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
tmu_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
tmu_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    101354164
   00240 Pyrimidine metabolism
    101354164
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    101354164
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tmu04131]
    101354164
Enzymes [BR:tmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     101354164
Membrane trafficking [BR:tmu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    101354164
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NDK Amidohydro_2
Motif
Other DBs
NCBI-GeneID: 101354164
NCBI-ProteinID: XP_004373213
UniProt: A0A2Y9DEP6
Position
Unknown
AA seq 169 aa AA seqDB search
MICLVLSIFANLFPAGCTGVHERTFVAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQA
SEELLREHYSELRARPFYGRLVRYMGSGPVVAMVWQGLDVVRASRALIGATDPADASPGT
IRGDFCIEIGKNVIHGSDSVESARREIALWFHADELLCWEDSAAHWLYE
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgatctgcctggtgctgagcatcttcgccaacctcttcccggcggggtgcaccggcgtg
cacgagcgcaccttcgtggccgtgaagccggacggcgtgcagcggcggctggtgggcgag
atcgtgcggcgcttcgagaggaagggcttcaagctggtggcgctgaagttggtgcaggct
tcggaggagctactgcgcgaacactattccgagctgcgcgcgcggcccttctacggccgc
ctggtgcgctacatgggatccgggccggtggtggccatggtgtggcaggggctggacgtg
gtgcgcgcttcgcgggcgctcatcggggccaccgacccagctgacgcctccccgggcacc
atccgcggggatttctgcatcgagatcggcaagaacgtgattcacggcagcgactcggtg
gagagcgcgcgccgcgagatcgccctgtggttccatgccgacgagctcctgtgctgggag
gacagcgccgcgcactggctgtacgagtag

DBGET integrated database retrieval system