KEGG   Trichechus manatus latirostris (Florida manatee): 101354225
Entry
101354225         CDS       T05135                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: A disintegrin and metalloproteinase with thrombospondin motifs 13
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:tmu01002]
    101354225
Enzymes [BR:tmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     101354225
Peptidases and inhibitors [BR:tmu01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   101354225
SSDB
Motif
Pfam: TSP1_ADAMTS ADAM_CR_2 TSP_1 Reprolysin Reprolysin_3 Reprolysin_4 TSP1_spondin Reprolysin_5 ADAM_spacer1 Peptidase_M10 Reprolysin_2 TSP1_CCN DUF4953
Other DBs
NCBI-GeneID: 101354225
NCBI-ProteinID: XP_004388761
UniProt: A0A2Y9E7L4
Position
Unknown
AA seq 1562 aa
MQGLPCWGRRPLLRKAGLGGLLAATVFLLGCRGISALQQRFLQALEPAEAASYFGPGSAV
KASRFAVALLTCVCEDGLGGPPCQAPRCCLRAWGQRFAFSFGPEPGLLTPASTSERVVNA
SLQWLQRPSAYCLTGGWALLPPGAVARVTYCSGRVEGDILLGGERLYVQPVRREHSTLAL
PWSRAWPHLVHSLAPSAPGRVRGTYPGREDTLGGPLPPSPTGRPPSPRLRRQTRAAGSVL
HLELLVAVGPDVYQAHQEDTERYMLTNLNIGSELLRDPSLGAQFRVHLVKMIVLTEPEDA
PNITANITSSLLSVCDWSRAVNPVDDTDPEHADLVLYITRFDLELPNGDQQVRGVTQLGG
ICSSSWSCLITEDTGFDLGVTIAHEIGHSLGLEHDGAPGSGCESSGHVMAADGAAPARGV
LAWSACSRRQLQHLLSAGRARCVWDPPRPQPEPAGRMPDAQPGLYYGVDEQCRVAFGRTA
VACTFARERLDMCQALSCHTDPLDLSSCSRLLIPLLDGTECGVDKWCSRGRCHSLAELPP
LPAVHGHWSSWGPPSPCSRSCGGGVVTRRRQCNNPRPAFGGHACAGADLQAELCNTQACG
TSQLEFMSEQCAQTEGQQLLLPEGGTTFYRWSSAAQYSQGDALCRHMCRAVGESFIMRRG
DSFVDGTRCVPSGPREDGTLSLCLSGSCRILGCDGRMDSGQVRDVCQVCRGDNSTCSPQN
GSFSAGRAREYVTFLTVTPNLTSVYVVNHRPLFTHLAVRIRGRYVVAGNASISPSTTYPS
LLEDSRLEYRVALTEDQLPHREELRIQGPVQEDIEIQVYRRYGEEYGSLARPDITFSYFQ
PKQPHAGTWAAVAGSCSVSCGAGQRWVTYSCLDKAQNKWVEPAQCSGSLKPPARLEPCTL
VPCPMRWAMGDLGPCSASWGSGLWEXVVPCVEARGGFPRMMPTAQCRAVAQPPAGAETCK
SQPCPTGWEVLAPGPATQNRTCVPEAEGQEALAAAGPCSTEEKLPELTPCIGMACHQGWG
HLDATSPGEEAPPPLGSARPGVLSAHPWIPLSGPCSVSCGRGLREVRFVCVDPTRGTAVP
EELCDLASRPRSRQEACQAALCPGRWETRALAPCPVTCGGGQVPLAMRCVRLDHGRTIPL
PHAKCGRLPRPDPLEDCSPEPCPARWRVLPAGPCSASCGLGTARRLVACVRLDQGQEIEL
DEVACVGLERPQATIPCLLARCAYRWHVSTWMECSVSCGNGIQRRQDSCLGPKARAPVPA
DFCQHLPKPVTVRGCWAGPCGEQGTPSPVPPKEVTAAGQTTEQPRAPARLPSPAPWTQGL
LASPRESPVESSVCGRQLLKPAGTIDLRGPGQADCVVAIGRPLGEVVTLHVLESSLDCSA
GEMLLLWSRLTWGKMCRKLAGTIFSSQSNTLTVRQRRVRPGGGVVLRYRGQPAPHPSHRE
CDMQLFGPWGEIVSPSLSPDGRSAGGCRVFISVAPRARMAVHALVTDVGIRTERTDTGYI
SIRDIHSLRTSTFRGQQSFYWESEGSQAEVEFSEGFLEARASLRGQYWTLHRAQEEGGPA
QP
NT seq 4689 nt   +upstreamnt  +downstreamnt
atgcaggggctaccgtgctgggggagacgcccccttctccgcaaggccggcctggggggc
ctcctcgcagccaccgtctttctcctgggctgccgcggaatctccgctttgcagcagagg
tttcttcaggctttggagccagcggaggcggcttcgtactttggcccgggttctgccgta
aaagcgtcccggtttgccgtggccctgctcacctgtgtctgcgaggacgggctcgggggg
ccgccctgccaagccccacgctgctgcctgcgcgcctggggccagcgcttcgccttctcc
ttcgggcctgagccgggcctcctcacgcccgcctccaccagtgagcgggtggtgaacgcc
tcactccagtggctgcagcggccttctgcctactgtctcacagggggctgggccctgctg
cccccgggtgccgtcgccagggtcacctattgctcaggccgcgtggagggtgacatcctg
ctgggcggggagcggctctatgtccagcccgtgaggagggagcacagcacgctggccctg
ccctggagtcgtgcctggccccacctggtccacagcctcgcccccagtgccccggggcgg
gtccgaggtacatatcctgggagggaggataccctgggtggacccctccctccttccccg
acaggccgtcctccctcccctcgtctccggagacagacacgggctgcagggagtgtcctg
cacctggagctgctggtggccgtgggccccgatgtctaccaggcccaccaggaggacaca
gagcgctacatgctcaccaacctcaacatcgggtcagaactgctgagggacccgtccttg
ggggctcagttccgagtgcacctggtgaagatgatcgtcctgacagagcccgaggatgct
ccaaacatcacagccaacatcacctcgtcactactgagcgtctgtgactggagcagggcc
gtcaaccctgtggatgacacggaccctgagcacgctgacctggtcctctacatcaccagg
ttcgacctcgagttgccaaatggtgaccagcaggttcggggagtcacccaacttgggggg
atctgttcctcctcctggagctgcctcatcaccgaggacactggcttcgacctgggggtc
accatcgcccatgagattgggcacagtctcggcctggagcacgacggcgcgcccggcagc
ggctgcgagtccagcggccacgtgatggcggccgatggcgccgcgcccgcccgtggggtt
ctcgcctggtccgcctgtagtcgccgacagctgcagcacttgctcagcgcaggacgggcg
cgctgcgtgtgggacccgccgcggccgcaacccgagcctgccgggcgcatgccagacgcg
cagcccggcctttactatggcgttgacgagcagtgccgcgtggccttcggtcgcaccgcc
gtcgcctgcaccttcgccagggagcgtctggacatgtgccaggctctctcctgccacaca
gaccccctggacctcagcagctgtagccgccttctcatccccctcctggacgggacggaa
tgtggtgtggacaagtggtgctccagggggcgctgtcactcactggcggagctgcccccc
ttgcctgcagtgcacgggcactggtccagctgggggccccccagtccttgctcccgctcc
tgcggaggcggcgtggtcaccaggagacggcagtgtaacaaccccagacctgcctttggg
gggcatgcatgcgcaggcgctgacctccaggctgagctgtgcaacacccaggcctgtggg
accagccagctggagttcatgtcagagcagtgcgctcagaccgaagggcagcagctgctc
ctccccgagggcggcaccaccttctaccgctggagctcggccgcgcagtacagccaaggg
gatgctctgtgcaggcacatgtgccgggctgtgggcgagagcttcatcatgaggcgtggg
gacagcttcgtggatgggacccgctgtgtgccgagtggcccgagggaggacgggaccctc
agcctgtgcctgtcgggcagctgcaggatcctgggctgcgatggcaggatggactccggg
caggtacgtgacgtgtgccaggtgtgcagaggagacaacagcacctgcagcccacagaat
ggctctttctcggccggaagagccagagagtatgtgacattcctcacggtcacccccaac
ctgaccagtgtctacgttgtcaaccacaggcctctcttcacacacttggcggtgaggatc
cgaggacggtacgttgtggctgggaacgcaagcatctcccccagcactacctacccctcg
ctgctggaggacagccgcctggagtacagggtggccctcactgaggaccagctgccccac
cgggaggagctacgcatccagggacctgttcaggaagacattgagatacaggtttacagg
cgctacggtgaggagtacggcagcctcgcccgcccagacatcaccttcagctatttccag
ccgaagcagccgcatgcggggacgtgggccgccgtggcggggtcctgttcggtgagctgt
ggggcagggcagcgctgggtgacctacagctgtctggacaaggcccagaacaagtgggtg
gagcctgcccagtgcagtgggagtctgaagccgccagcacggctggagccttgcaccctt
gtgccctgccccatgcggtgggccatgggggacttgggcccgtgcagtgcctcctggggg
agtggcctgtgggagtgagtggtgccctgtgtggaggcccggggtggtttcccaaggatg
atgcccactgcccagtgcagagcagtggcccagccgccagctggggcagaaacctgcaag
tcccagccctgccccacgggctgggaggtgttggcccccggcccagccacacagaacagg
acatgtgtgccagaggcagaaggccaggaggctctggcggctgctgggccatgctccaca
gaggagaagctgcctgaactcacaccctgcatcgggatggcatgccaccagggctggggt
catctggatgcgacgtctccaggggaggaagctccgcccccactgggcagtgccaggcca
ggggttctcagtgcacacccatggattcctctgagcgggccctgctccgtctcctgtggc
cgaggcctgagggaggtgcgcttcgtgtgcgtggaccctacccgtggcacagcagtcccg
gaagagctgtgtgacctagcgagcaggcccaggagccggcaggaggcctgccaagctgct
ctgtgtcccggacggtgggagactcgagccttggcaccatgcccagtgacctgcggaggt
ggccaggtgccactggctatgcgctgtgtgaggctggaccacggtcgcaccatccccctg
ccccatgccaagtgcgggcggctgccccggcccgatccccttgaggactgcagcccggag
ccctgccccgccaggtggagggtcctgccagcgggcccctgctcagccagctgcggcctt
ggtaccgcccggcgcttggtggcttgcgtgcggctggaccaaggccaagagattgagctg
gacgaggtggcctgtgtgggcctggaacggccgcaggccaccatcccctgcctgcttgcc
cgctgtgcctaccggtggcatgtcagcacgtggatggagtgctccgtctcctgcgggaac
ggcatccagcgccggcaggactcctgcctcggaccaaaggcccgggcgcccgtgccagct
gacttctgccagcatttgcccaagccagtgacggtgcggggttgctgggcgggtccctgt
ggagagcaggggacgcccagcccggtgccccccaaggaagttactgctgcaggccagacc
acagagcagccgagggcccctgctcgcctcccctctcccgctccctggactcaggggctc
ctggccagcccccgagaaagccctgtggagtccagtgtctgtggacggcagctcctcaag
ccagcaggaaccattgaccttcgaggcccagggcaggcggactgcgtggtagccatcggg
cggccactgggggaggtggtcaccctccacgtccttgagagttccctcgactgcagtgct
ggggagatgctgctgctgtggagtaggctcacgtgggggaagatgtgcaggaagctggct
ggcaccatcttcagctcccagagcaacaccctgaccgtgaggcagcgccgggtgcggcca
ggcggtggcgtggtgctgcggtacaggggccagcctgccccgcacccgtcccaccgagaa
tgtgacatgcagctctttggaccctggggtgaaattgtgagcccctcgctgagtccagac
gggaggagcgcggggggctgccgggtcttcatcagtgtggctcctcgggcccggatggcc
gtccacgccctggtcaccgacgtgggcataaggactgagcggacagacactggctacatc
tcgatccgggacatccacagcctgaggacctcgacgttccgcgggcagcagtcgttctac
tgggagtcagagggcagccaggccgaggtggagttcagcgagggcttcctggaggcgcgc
gccagcctgcggggccagtactggaccctccatagagcgcaggaagaggggggcccggcc
cagccctag

DBGET integrated database retrieval system