KEGG   Trichechus manatus latirostris (Florida manatee): 101354440Help
Entry
101354440         CDS       T05135                                 

Definition
(RefSeq) arylamine N-acetyltransferase 1-like isoform X1
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu00232  Caffeine metabolism
tmu00983  Drug metabolism - other enzymes
tmu01100  Metabolic pathways
tmu05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    101354440
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    101354440
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    101354440
Enzymes [BR:tmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     101354440
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acetyltransf_2
Motif
Other DBs
NCBI-GeneID: 101354440
NCBI-ProteinID: XP_004382152
UniProt: A0A2Y9RKF4
Position
Unknown
AA seq 290 aa AA seqDB search
MDIEAYFERIGYTDSRKTLDLETLTDILQHQIRAIPFENLNIHCEEEMKLDLKTIFEQIV
RGKRGGWCLQVNYLLYWALTTMGFETTMLGGYVYSTPDDRYSNNMIHLLLQVTIDGTNYI
ADAGFGCSYQMWQPLELIPGKDQPQIPCIFRLREEGGIWYLDQIRREQCIPNEEFLNSDL
LEKNKYRKIYSFTLEPRTIEDFASVNTFLQTSPASVFTSKSFCSLQTQEGVHCLVGLTLT
SRRFNYKDNMDLVEFKTLKEDEVKEVLKNLFSISLQKKLVPKLGDRFFTI
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggacattgaagcatattttgaacgtattgggtatacagactctaggaagacattggac
ttggaaacattaactgacatccttcaacaccagatccgagccattccctttgagaacctc
aacatccattgtgaagaagaaatgaagttggacttaaagaccatttttgaacaaattgtg
agggggaagcgaggtgggtggtgtctccaggtcaattatctcctgtactgggctctgact
acaatgggttttgagaccacaatgttgggaggttatgtctacagcactccagatgacaga
tatagtaataacatgattcatctcctgttgcaagtgaccatagatggcacaaactacata
gcagatgctggctttggatgttcctaccagatgtggcagcctctggagctaattcctggg
aaggatcaacctcagataccctgcatcttccgcttgagggaagagggaggaatctggtac
ctagaccaaatcagaagagagcagtgcattccaaatgaagaatttcttaattctgatctc
ctggaaaagaataaatatcgaaaaatctactcttttactcttgagcctcgaacaattgaa
gattttgcctccgtgaacacgttccttcagacatctccagcgtctgtgtttacaagcaaa
tctttttgttccttgcagacacaagaaggggttcactgtttagtgggcctcaccctcacc
tctcgaaggttcaattataaggacaatatggatctggtagagtttaagaccctaaaagag
gacgaagtaaaagaagtgctgaagaatctgttcagtatttccttacagaaaaaacttgtg
cccaaacttggtgaccgattttttactatttag

DBGET integrated database retrieval system