KEGG   Trichechus manatus latirostris (Florida manatee): 101354876Help
Entry
101354876         CDS       T05135                                 

Definition
(RefSeq) NK-tumor recognition protein isoform X1
  KO
K12740  NK-tumor recognition protein
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:tmu03110]
    101354876
Chaperones and folding catalysts [BR:tmu03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    101354876
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase
Motif
Other DBs
NCBI-GeneID: 101354876
NCBI-ProteinID: XP_023581750
UniProt: A0A2Y9QEK7
Position
Unknown
AA seq 1463 aa AA seqDB search
MGAQDRPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYK
GSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNG
SQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGVIATKS
TKDVFEKKRKKPTHSEDSDSSSSSSSSSESSSESEIEHERSRRRKHKRRPKVKHSKKRRK
EASGSEEPRSKHSLSPKGNSERSDTNEKKSVDSNAKREKPVVRPEEIPPVPENRFLLRRD
MPVVTVEPEPKIPDVAPIVSDQKPSVSKSGRKIKGRGTIRYHTPPRSRSCSESDDDDSSE
TPPHWKEEMQRLRAYRPPSGEKWSKGDKLSDPCSSRWDERSLSQRSRSWSYNGYHSDLST
ARHSDGHHKKRRKERKVKHKKKAKKQKHCRRHKQTKKRTVIVPSDVESSKSSTRQTKFSC
DRERRSRSSSLSSRHSSRRDWSKSDKDNQSSSTHSSRDSYRSKSHSRSYSRGSSRSRTAS
RSSSHSRSRSKSRSSSKSGHQRTASKSPRTASQLSENKPVKTEPLRVTVPQNENVVVQPV
VAENIPVIPLSDSPPPSRWKPGQKPWKPSYERIQEMKAKTTDLLPTQSAYSLANVKETGS
SSSYHKREKHPESDRSAYSKYSDRSSESSPRSRSRSSRSRSYSRSYTRSHSLVSSHSRSR
SPSSRSHSRNKYSDHSEYSRSSSYSSVSSDDRRLTKRRFRSSGKKNSTSGKRHSSSSEKT
LGNKYVKGRDKSSYQRKYSEGRSSLDYSSDSEQSSVQVVQSAREKEKQVQIEVTNNKQEK
KRDEEKSKPERECPRSKKRTLKENFSDHLRNGNKPKRKNYAGSKWDSESNSERDVTKNSK
NDSRPSSDKEEGEATSDSESEFGEIHIKTKPTTKSLANTSLPDSNSVWKPSQPRSSTSDS
GGSCSNSENNRGKLQKHKHGSKENLKREHTKKMKEKLKGKKDKKHKAPKRKQAFHWQPPL
EFGEEEEEEINEKQVTRESKEKKQVSENGETIKDDTQKTEKSCEDGSVSGKHNAVNISSD
LEQHTKDERKLSISPTVLNTEENVASSPPNIQHIEESVPSGVEDVLQTDDNMEICTPDRS
SPAKVEEASPLGNSRFDPPDVSTVLKQDVQTENPEAEVVKQESGVSESKMTGEVGKQDSG
AAGLANAVESTVKREMAEKSQTSLVDNKWKPLQGVGNLAAPTLTSSGAVEVKTSTAVPEM
KPQGLRIEIKSKNKVRPGSLFDEVRKTARLNQRPRNRESSSDEQTASRDGDSQSRSLSRS
RSKSETKSRHRTRSVSYSHSRSRSRSSTSSYRSRSYSRSRSRGWYSRGRTRSRSSSYRSY
KSHRSSSRSRSRSSSYDPHSRSSRSYTYDSYYSRSRSRSRSQRSDSYHRGRSYNRRSRSY
GSDSESDRSYSHHRSPSESSRYS
NT seq 4392 nt NT seq  +upstreamnt  +downstreamnt
atgggagcgcaggaccggccgcagtgccacttcgacatcgagatcaaccgggagccggtt
ggtcgtattatgtttcagctcttctcagacatatgtccaaaaacatgcaaaaacttcctt
tgcctatgctcaggggagaaaggccttgggaaaacaactgggaagaagttatgttataaa
ggttctacattccatcgtgtggttaaaaactttatgattcagggtggggacttcagtgaa
ggtaatggaaaaggtggagaatcaatttatggtggatatttcaaagatgaaaactttatt
ctcaaacatgacagagcgttccttttgtcaatggcaaatcgagggaaacataccaatggt
tcccagtttttcattaccacaaaacctgcaccacacctggatggggtgcatgttgtcttt
ggactagttatttctggttttgaagtaatcgaacaaattgaaaatctgaaaactgatgct
gcaagccggccttatgcagatgtgcgagttattgactgtggagtgattgccacgaaatca
acaaaagatgtttttgagaaaaagaggaagaaaccaactcattcagaagactcggattcc
tcctccagttcttcttcctcttcagaatcatcttcagaaagtgaaatcgaacatgagagg
agcagaaggaggaaacataagaggaggccaaaggttaaacattctaaaaagagacgaaag
gaagcgagcggttcagaagagccaaggagcaaacattcattgagcccgaaaggtaactct
gagaggagtgataccaatgaaaaaaagtcagtcgattcaaatgctaaaagggaaaagcct
gtggtgcgcccagaagagatccctccagtgcctgagaaccgattcttactgagaagagat
atgcctgtggtcactgtggaacctgaaccgaagattccggatgttgcacccattgtaagt
gatcagaaaccatctgtatcaaagtctggacggaagattaaaggaaggggcacgattcgc
tatcacacacctccacgatcaagatcctgttctgaatcagatgacgatgacagcagtgaa
acacctccacactggaaagaggagatgcagaggttaagagcgtacagaccacctagtggg
gaaaaatggagtaaaggagataagttaagtgacccctgttcaagccgatgggatgaaaga
agcttgtcccagagatccagatcatggtcctataatggatatcattcagaccttagtaca
gcaagacactctgatggtcaccataaaaaacgcagaaaagagagaaaggttaagcataaa
aagaaagctaaaaagcagaaacattgtagaagacacaaacagactaagaagagaacagtt
atcgtaccatctgatgtagaatcctcaaaatcttccacccgacaaacaaaattttcttgt
gatagggaaaggagatctcgttcttcctcattgtcttctcgtcattcatcaaggagggac
tggtctaaatctgataaagataaccagagctcttcaacccattccagcagagactcatac
agatcaaaatctcactcccggtcttactctagaggaagctcaagatcaaggactgcatca
agatcttcatcacattctcgaagtagatccaagtccagatctagttcaaagtcaggtcac
caaaggacagcatcaaaatcaccaagaacagcctctcagttaagtgaaaataaaccagtt
aaaacagaacctttaagagtaacagtgccacaaaatgaaaacgtagtagtccaaccagtg
gtggcagaaaatattcctgtaataccattgagtgacagtcccccgccttcaaggtggaag
cctgggcagaagccttggaagccctcttatgagcgaattcaggaaatgaaagctaaaaca
accgatttgctgcccacccaaagtgcttatagcttagcaaatgtgaaagagactggtagt
tcatcatcctaccataaaagagaaaaacatccagaaagcgatcggagtgcttattccaaa
tacagcgatagaagttcagaaagttcacctaggtccaggagcagatcttctaggagtaga
tcttattccagatcgtatacaaggtcacatagtctggttagctcacattcaaggtctagg
tcgccatcatctagatctcattcacgaaataaatacagtgatcattcagagtatagtaga
tcatcttcatactcttctgttagcagcgatgatagaagactaaccaagaggaggtttaga
tccagtgggaaaaaaaacagcacttcaggtaaaaggcacagcagcagctctgaaaagaca
cttggcaataaatatgtcaaaggcagagacaagtcttcatatcagagaaagtatagcgaa
ggcaggtcatctttagattattcttcagacagtgagcagtcaagtgttcaggttgtacag
tcagcccgggaaaaagagaagcaagtccaaatcgaagtaactaataataaacaagagaaa
aagagagatgaagagaaatccaagcctgaacgggaatgccctcgttcaaaaaaaagaact
ttgaaagagaatttttctgatcacttaagaaatggtaataagcccaaaaggaagaattat
gctgggagcaaatgggactctgagtcaaattcagaacgagatgtgactaaaaacagtaaa
aatgattctcggccgtcttctgataaggaagaaggtgaggctacatcagattctgaatca
gagtttggtgaaattcacatcaaaaccaaacctacaacaaagtctttagcaaatacttca
ctgcctgatagcaatagtgtttggaaaccaagccaaccgcggtcatcaacctctgattct
ggggggtcctgttccaattcagaaaacaacagaggaaagctacagaagcacaaacatggg
tcaaaggaaaatcttaaaagagaacacaccaaaaagatgaaagagaaattgaaagggaaa
aaagacaaaaagcacaaggctccaaaacgaaaacaagcttttcactggcagcctccacta
gaatttggtgaagaggaggaggaggagattaatgaaaagcaagttactcgggagtcaaaa
gaaaaaaaacaagtttctgaaaatggtgaaaccataaaagatgacactcagaaaactgag
aagtcctgtgaagacggcagcgtttcaggtaaacataatgcggtgaatatctcatcagat
cttgagcagcatactaaagatgagcgtaaactcagcatttctcccacagttttaaatact
gaggaaaacgtagccagttcacccccaaacatccagcatattgaagagagtgtcccaagt
ggagtggaggatgtgcttcaaacagatgataacatggagatttgcactcctgataggagt
tccccagcaaaggtagaggaggcttcccctctaggaaactccaggtttgaccccccagat
gtaagcactgttctcaagcaggatgtgcagacggagaatcctgaggcagaggtagtaaaa
caggaaagtggcgtgtctgaaagcaaaatgacaggtgaagtggggaaacaggacagtggc
gcggccggcttggccaatgctgtagaaagtaccgtgaagagggagatggctgagaagagc
cagaccagcctcgtggataacaagtggaagcccctgcaaggtgtggggaacctggcagca
cccactcttacttcatctggtgctgtggaagttaagacatcgactgctgtccctgaaatg
aaaccacagggcttaagaatagaaattaagagcaaaaataaagttcgacctggatctctc
ttcgatgaagtaagaaagacagcacgcttaaatcagaggccaagaaatcgagagagttca
agtgatgaacagacagctagtcgggatggtgatagccagtccaggagcctaagtagatct
cgaagtaaatctgaaaccaaatcaagacacagaacaaggtctgtctcctatagtcactca
agaagtcgatcgcgaagttccacgtcctcttatcgatcaagaagctactcaagaagtcgg
agcaggggatggtacagcagaggtcgcacaaggagccggagcagttcctaccgcagttac
aaaagtcacaggtcgtctagcaggagcagatccaggagcagctcgtatgatccccacagt
cgatccagcaggtcctacacttacgatagctactatagcaggagtcggagtcgaagcaga
agtcagagaagtgacagttaccaccgaggcagaagttacaataggcggtccagatcttat
ggctctgacagtgaaagtgaccggagttactctcatcaccggagccccagtgaaagcagc
agatacagctga

DBGET integrated database retrieval system