KEGG   Trichechus manatus latirostris (Florida manatee): 101354887
Entry
101354887         CDS       T05135                                 

Definition
(RefSeq) ankyrin repeat domain-containing protein 53
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:tmu03036]
    101354887
Chromosome and associated proteins [BR:tmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    101354887
SSDB
Motif
Pfam: Ank_5 Ank_2 Ank Ank_3 Ank_4
Other DBs
NCBI-GeneID: 101354887
NCBI-ProteinID: XP_004369428
UniProt: A0A2Y9D7N0
Position
Unknown
AA seq 503 aa
MRQTEKALSKATRGELASRQFRAWGGRGSTERSEKPGERDGGRAHLPRGALASRFLTAFQ
SRQPWPRLQKRLRTLNEESDQGEIGNYELFAAAVGNVEWLRFCLNRNTGEIPADSKGFTA
IHFAAQRGKLACLQVLVEEYKFPVNQPTNNGQTPLHLVVHRDNKTMVLPCIHYLLRKKAA
INAQTQNGCTPLHVAAREGLLGCLKVLVENGANVHAEDATGCKPIDLCKIWNHRTCARFL
KDAMWKRDKKDFAREMQDLKRLKDRLILLERHYLTEYQKECEALNEADFKKWLRCKLLLA
SKTKQAPGASPSATAPTKTPECPGSHPFLEARLRHKPQPTLQPMVARTSLLYSLPTVTRP
MLWDQCSNPARFPTTKTSYLQGIRLGVQPDPTREHDLCNFVKVSPDRQGGALLHTVTGRL
VAPVPQLPFEVVVRELYPSQQPYRMKVPQGFYPVSLRDVPQKWRLGNNTFWTDTVAMNLR
ETFDETFLTALRAHQGLPILPSP
NT seq 1512 nt   +upstreamnt  +downstreamnt
atgcggcagacggagaaagccctctcgaaggccacccgtggtgaattggcctctaggcag
ttcagggcctggggcgggcggggatcgaccgaacggagcgagaagcccggggagcgggat
ggaggccgggctcacctccccagaggcgccttggcgagccgtttcctcacggccttccag
tccaggcagccctggcctcgcctccagaaacgcctccggaccctcaacgaggagtccgac
cagggggagattggcaactatgagttattcgctgccgcggtgggcaacgtagaatggctg
cggttctgtctgaaccgaaacactggggaaatcccagcggacagcaagggcttcaccgcc
atccactttgcagcccagcggggcaagcttgcatgcctgcaggtcttggtggaggagtac
aagtttcctgtgaaccaacccaccaacaatggccagacccccctgcacctagttgtccac
agggacaacaagaccatggtcctcccctgcattcactatctgctcaggaaaaaggcggcc
atcaacgctcaaacacaaaatggctgcactcccctgcatgtggcagcccgtgagggcctg
ctgggctgtttgaaggtcctggtagagaatggtgccaatgtccatgccgaagatgccacg
ggctgcaaacccatcgacttatgcaaaatatggaaccaccgcacctgtgcccggttcttg
aaggatgccatgtggaaacgggacaagaaggactttgcccgtgagatgcaggacctgaag
aggctcaaggacaggctgatcctcttggagcggcattacctgactgagtatcaaaaagag
tgtgaagccctgaatgaagccgatttcaagaagtggctccgctgcaagctgctgctggcc
agcaaaaccaagcaggcgcctggtgcctcaccttcagccactgcccctacaaagaccccc
gagtgccctgggtcgcatcctttcctggaggcgcgcctgcgacacaagccgcagcccacg
ctgcagcccatggtagcgcgaacatccctgctgtacagcctgcccacagtcacgcggccc
atgctgtgggaccaatgcagtaaccctgccagattccccaccaccaagaccagctacctg
cagggcatccgcctgggcgtgcagccagaccccacccgggagcacgacttatgcaacttc
gtgaaggtgagcccggacaggcaaggaggtgcgctgctgcacacagtcactggccgcctg
gtggcacccgtgccccagctgccttttgaagtagtggtccgtgagctgtacccctcgcag
cagccatataggatgaaggtaccccagggcttctaccccgtcagcttgagggacgtgccc
cagaagtggcgcctgggcaacaacaccttctggacagacactgtggccatgaacctgcgt
gagacatttgatgaaaccttcctgacagccctgcgtgctcatcaaggactccccatcctg
ccctccccctaa

DBGET integrated database retrieval system