KEGG   Trichechus manatus latirostris (Florida manatee): 101355025Help
Entry
101355025         CDS       T05135                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase FKBP4 isoform X1
  KO
K09571  FK506-binding protein 4/5 [EC:5.2.1.8]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu04915  Estrogen signaling pathway
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    101355025
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:tmu03110]
    101355025
Enzymes [BR:tmu01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     101355025
Chaperones and folding catalysts [BR:tmu03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    101355025
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C TPR_1 TPR_2 TPR_8 TPR_12 TPR_11 FKBP_N_2 TPR_6 TPR_9 PknG_TPR TPR_19 TPR_14 TPR_16 TPR_17 OmpH
Motif
Other DBs
NCBI-GeneID: 101355025
NCBI-ProteinID: XP_004381245
UniProt: A0A2Y9DU37
Position
Unknown
AA seq 459 aa AA seqDB search
MTAEEMKAAESGAQSAPLPLEGVDISPKQDEGVLKVIKREGTGTERPMIGDRVFVHYTGW
LLDGTKFDSSLDRKDKFSFDLGKGEVIKAWDIAVATMRVGEVCHITCKPEYAYGLAGSPP
KIPSNATLVFEIELFEFKGEDLTEDEDGGIIRRIRTRGEGYARPNDGAIVEVALEGYYKD
RMFDQRELQFEIGEGENLDLPCGLEKTIQRMEKGEHSIVYLKPSYAFGSVGKEKFQIPPH
AELTYEIHLKSFEKAKESWEMNPEEKLEQSTIVKERGTGYFKEGKYKQALLQYKKIVSWL
EYESSFSGEEAQKARALRLASHLNLAMCYLKLQSFSAVIENCNKALELDSNNEKGLFRRG
EAHLAVNDFELARADFQKVLQLYPSNKAAKAQLAICQQRIRKQLAREKKLYANMFERLAE
EDSKAKAEVAAGDRSSDVEMKDEQKNNVAGSQAQVETEA
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcggaggagatgaaagccgcggagagtggggcgcagtcggcgccgctgcccttg
gagggcgtggacatcagccccaagcaagatgaaggcgtgcttaaggtcatcaagcgagag
ggcacaggcacagagaggcctatgattggggaccgggtctttgtccactacactggctgg
ctgttagatggcaccaagtttgactccagtctggaccgcaaggacaaattctcctttgac
ctaggaaaaggagaggtcatcaaggcttgggacattgcggtagcaaccatgagggtggga
gaagtgtgccacatcacctgcaaaccagaatatgcctatggtttggcgggcagtcctcca
aagatcccctccaacgccacgcttgtgtttgagatagagctgtttgagttcaagggagag
gacctgacagaagatgaagatggaggcatcatccgcagaatacggactcggggtgaaggc
tatgccaggcccaatgatggagctattgtggaggttgcactggaagggtactacaaggac
cggatgtttgaccagcgggagctccagtttgagatcggtgagggggagaatctggatctt
ccttgtgggctggagaagaccattcagcgcatggagaaaggagaacattccattgtgtac
ctgaaacccagctatgcttttggcagtgttgggaaggaaaagttccaaatcccaccacat
gccgaactgacatatgaaattcacctcaagagttttgagaaggccaaggagtcttgggag
atgaatccggaggagaagctggaacagagcaccatagtgaaggagcggggcactgggtat
ttcaaggagggcaagtacaagcaagctttgctgcagtacaagaagattgtgtcctggttg
gaatatgagtcgagtttctccggtgaggaagcacaaaaggcacgggctcttcgactggcc
tcccacctcaatctggccatgtgttacctgaaactgcagtccttctcagctgtcattgaa
aactgcaacaaggccctggaactggacagcaacaatgagaagggcctcttccgccgggga
gaggcccacctggcagtgaatgactttgagttggcacgggctgacttccagaaggtcctg
cagctctaccccagcaacaaggctgccaaggcccagctggctatctgtcagcagcggatc
cgcaagcagctcgcgcgggagaagaagctctatgccaacatgtttgagaggctggctgag
gaggacagcaaggccaaggcagaagtagctgcaggagaccgcagttctgacgtagagatg
aaggacgagcagaagaacaatgtggcagggagccaggctcaggtggagacagaggcatag

DBGET integrated database retrieval system