KEGG   Trichechus manatus latirostris (Florida manatee): 101355560Help
Entry
101355560         CDS       T05135                                 

Definition
(RefSeq) NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial
  KO
K03936  NADH dehydrogenase (ubiquinone) Fe-S protein 3 [EC:7.1.1.2 1.6.99.3]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu00190  Oxidative phosphorylation
tmu01100  Metabolic pathways
tmu04714  Thermogenesis
tmu04723  Retrograde endocannabinoid signaling
tmu04932  Non-alcoholic fatty liver disease (NAFLD)
tmu05010  Alzheimer disease
tmu05012  Parkinson disease
tmu05016  Huntington disease
Module
tmu_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101355560
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    101355560
  09159 Environmental adaptation
   04714 Thermogenesis
    101355560
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101355560
   05012 Parkinson disease
    101355560
   05016 Huntington disease
    101355560
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101355560
Enzymes [BR:tmu01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.99  With unknown physiological acceptors
    1.6.99.3  NADH dehydrogenase
     101355560
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     101355560
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Complex1_30kDa
Motif
Other DBs
NCBI-GeneID: 101355560
NCBI-ProteinID: XP_004387771
UniProt: A0A2Y9E7B0
Position
Unknown
AA seq 261 aa AA seqDB search
MAAARGWWRGLVGAAALARGVVRPSALLLPVRRESATADTRPTVRPRNDVAHKQLSAFGE
YVAEILPKYVQQVQVSCFNELEICIHPDGIIPVLTFLRDHTNAQFRSLADLTAVDIPTRQ
NRFEIVYNLLSLRFNSRIRVKTYTDELTPIESTVSVYKAANWYEREVWDMFGVFFANHPD
LRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWEAFP
AYRQPPENLKLEAGDKKPEAK
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcaaggggctggtggcgggggctcgtgggggccgcggcactggcccgggga
gtcgtgcgaccttcggcactattgctgcctgtgaggagagagagcgccacagccgacacg
cgccccactgtcagaccacggaatgacgtggcccacaagcagctttcagcttttggagag
tatgtggctgaaatcctgcccaagtatgtccaacaagttcaggtgtcctgcttcaatgaa
ttagagatctgtatccatcctgatggcatcatcccagtgctgaccttcctcagggatcac
accaatgcacaattcagatccttggctgacttaacagcagtggacatcccaacccggcaa
aaccgttttgagattgtctacaacctgctttctctgcgtttcaactcacggatccgtgtg
aagacctatacagatgagctgacacccattgaatctactgtctctgtgtacaaggcagcc
aactggtatgagagggaggtctgggacatgtttggagtcttctttgctaaccaccctgac
ctaagaaggatcctaacagactatggctttgagggacatcctttccggaaggacttcccc
ttgtctggctatgttgagctacgctatgacgatgaggtgaagagggtggtggccgagcca
gtggaattggcccaagagttccgcaagttcgacctaaacagcccctgggaggctttccct
gcctaccgccagccccctgagaatctcaagcttgaggccggagacaaaaaacctgaagcc
aagtag

DBGET integrated database retrieval system