KEGG   Trichechus manatus latirostris (Florida manatee): 101356588Help
Entry
101356588         CDS       T05135                                 

Definition
(RefSeq) glutathione peroxidase 1
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu00480  Glutathione metabolism
tmu00590  Arachidonic acid metabolism
tmu01100  Metabolic pathways
tmu04918  Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    101356588
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    101356588
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    101356588
Enzymes [BR:tmu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     101356588
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx Redoxin AhpC-TSA
Motif
Other DBs
NCBI-GeneID: 101356588
NCBI-ProteinID: XP_004368582
UniProt: A0A2Y9D6A4
Position
Unknown
AA seq 207 aa AA seqDB search
MCAALGADVAALAAAVPRSVHAFSARRLAGGEPVSLGSLRGKVLLIENVASLUGTTVRDY
TQMNDLQRRLGPRGLVVLGFPCNQFGHQENAKNEEILNCLKYVRPGGGFEPNFTLFEKCE
VNGAQAHPLFAFLREALPAPSDDATALMTDPKFIIWSPVCRNDISWNFEKFLVGPDGVPV
RRYSRRFPTIDIEADIEALLSKGPSSA
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgcagctctaggcgcggacgtagccgccctcgcggcggcagtcccgcgctcggtg
cacgccttctctgctcgccgcctggccggcggggagccagtgagcctgggctcgctgcgg
ggcaaggtgctgctcatcgagaacgtggcgtcgctctgaggcaccacggtccgggactac
acccagatgaatgatctgcagcggcgcctcggcccccggggcctggtcgtgctcggcttc
ccgtgcaaccagtttggccatcaggagaacgccaaaaacgaagagatcctgaattgcctc
aagtacgtaagaccaggcggcgggttcgagcccaacttcacgcttttcgagaagtgcgag
gtgaacggcgcacaggcacacccgctcttcgcctttctgcgggaggccctgccggcgccc
agcgacgatgccactgcactcatgaccgatcccaagttcatcatctggtctccggtgtgc
cgcaacgacatctcctggaacttcgagaagttcctagtgggtcccgacggtgtgcctgtt
cgcaggtacagccgccgcttcccaactatcgacatcgaggccgatatcgaagccctgctg
tctaaggggcccagcagtgcctag

DBGET integrated database retrieval system