KEGG   Trichechus manatus latirostris (Florida manatee): 101357774Help
Entry
101357774         CDS       T05135                                 

Definition
(RefSeq) glycogen [starch] synthase, liver
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu00500  Starch and sucrose metabolism
tmu01100  Metabolic pathways
tmu04151  PI3K-Akt signaling pathway
tmu04152  AMPK signaling pathway
tmu04910  Insulin signaling pathway
tmu04922  Glucagon signaling pathway
tmu04931  Insulin resistance
Module
tmu_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    101357774
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    101357774
   04152 AMPK signaling pathway
    101357774
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101357774
   04922 Glucagon signaling pathway
    101357774
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101357774
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:tmu01003]
    101357774
Enzymes [BR:tmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     101357774
Glycosyltransferases [BR:tmu01003]
 Polysaccharide
  Storage polysaccharide
   101357774
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4
Motif
Other DBs
NCBI-GeneID: 101357774
NCBI-ProteinID: XP_004390688
UniProt: A0A2Y9EBF4
Position
Unknown
AA seq 711 aa AA seqDB search
MLRGRSLSVTSVSGLPRWEVEELPVEDFLLFEVSWEVTNKVGGIYTVIQTKAKTTAEEWG
DNYFLIGPYFEHNMKTQVEPCEPLNETVRRAVDTMNKHGCQVHFGRWLIEGSPYVVLFDI
SYSAWNLDRWKGDLWEACSVGIPYHDREANDMLIFGSLTAWFLKEVTDHADDKHVIAQFH
EWQAGTGLILSRARKLPIATIFTTHATLLGRYLCAANTDFYNRLDKFDIDKEAGERQIYH
RYCMERASVHCAHVFTTVSEIAAIEAEHMLKRKPDVITPNGLNVKKFSAVHEFQNLHAMY
KARIQDFVRGHFYGHLDFDLEKTLFLFIAGRYEFSNKGADIFLESLSRLNFLLRMHKSDV
TVVVFFIMPAKTNNFNVETLKGQAVRKQLWDTARSVKEKFGKKLYDALLKGEIPDMNSIL
DRDDLTIMKRAIFSTQRHSLPPVTTHNMIDDSTDPILSTIRRIGLFNSRTDRVKVILHPE
FLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMQE
HVADPTAYGIYIVDRRFSSPDDSCNQLTKFLYGFCKQSRRQRIIQRNRTERLSDLLDWRY
LGRYYRHARHLTLSRAFPDKFHMEPTPPPTTEGFKFPRPPSVPPSPSLSQASSPQSSDVE
DDEDERYNEEEEAERDRLNIKSPLSLGHVPHGKKKLHGEYKKLNSLLAEQS
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
atgctccggggccgatccctatctgtgacatccgtgagcgggcttcctcggtgggaagtt
gaagaacttcctgtggaggattttctgctctttgaagtttcttgggaagtgaccaataaa
gttggtggcatctatactgtgattcagacaaaggccaagacaacagcagaagaatgggga
gacaattatttcctaataggtccgtattttgagcataatatgaagactcaggtggaaccg
tgcgaacctctaaatgagactgttagaagagcagtggacacaatgaacaagcacggatgc
caggtgcattttggaagatggttaatagaagggagtccttacgtggtgctctttgacatc
agctattcggcttggaatctggatagatggaagggtgacctctgggaagcgtgcagtgtt
ggcatcccttatcatgaccgagaagccaatgacatgctgatattcggatctttaactgcc
tggttcttaaaagaggtgacagatcatgccgatgataaacacgtcattgcccaattccat
gaatggcaggccggaactggactgatcctttcccgagcccggaaacttcctattgccaca
atatttactacccacgccactctgctcgggaggtatctatgtgcagcaaacactgatttc
tacaaccgtcttgataagtttgacatagacaaagaggccggggaaaggcagatttaccac
cggtactgcatggagcgagcctctgttcattgtgcccatgtgttcactacagtttctgaa
attgcagcaatagaagcagaacacatgctgaagagaaaacctgatgtcattactccaaat
ggcttgaatgttaagaaattttcagcagtacatgagtttcaaaatctacatgccatgtat
aaggccaggatccaagattttgttcgaggtcatttctatggtcatcttgactttgatctt
gaaaagactttgttccttttcattgctgggaggtatgaattttcaaacaaaggagccgac
atcttcttagagtccttatccaggctgaatttcctgctgaggatgcataaaagtgacgtc
acagtggtggtgtttttcattatgcctgccaagacaaataatttcaatgtggaaaccctg
aaaggacaggcagtgcgaaaacagctatgggacactgcacgttctgtgaaggaaaagttc
ggaaagaaactctatgatgctttattaaaaggagaaattcctgacatgaacagtattctg
gatagagatgatctaacaattatgaaaagagccatcttttcgactcagcgacattctttg
cctccagtgaccactcacaacatgattgatgattccaccgatcccatcctcagcaccatc
agacgtatcggacttttcaacagtcgcacagacagagtcaaggtgattttacacccagag
ttcctatcctccaccagccccttattacccatggattatgaagagtttgtcagagggtgt
catcttggggtatttccatcatactatgaaccctggggctatactccagctgaatgcact
gtgatgggtatccccagcgtgacaacaaacctctccggctttggctgtttcatgcaggag
cacgtggctgatcctactgcatatggtatttacattgttgacaggcggttctcttctccg
gatgattcttgcaaccagctgactaagtttctctatggattttgcaaacagtcgcgccgc
caaaggattatccagagaaaccgaactgagaggctctcagatcttctggactggagatac
ttaggcagatattaccggcatgccaggcacctgacgttgagcagagcttttccagataaa
ttccacatggaaccaacaccaccaccaacgaccgaaggatttaaattccccaggcctccc
tcagtaccaccttctccttcactgtctcaggcctccagtcctcagagcagtgatgtggaa
gatgatgaggatgagcgatacaacgaggaagaggaggctgaaagggatcggttaaatatc
aagtcgccactttctctgggtcatgttcctcatggcaagaaaaagctccatggtgaatat
aagaaactgaattccttacttgctgaacagagctga

DBGET integrated database retrieval system