KEGG   Trichechus manatus latirostris (Florida manatee): 101358970
Entry
101358970         CDS       T05135                                 

Definition
(RefSeq) acid-sensing ion channel 1 isoform X1
  KO
K04829  acid-sensing ion channel 1
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09150 Organismal Systems
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101358970
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:tmu04040]
    101358970
Ion channels [BR:tmu04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   101358970
SSDB
Motif
Pfam: ASC
Other DBs
NCBI-GeneID: 101358970
NCBI-ProteinID: XP_004388367
UniProt: A0A2Y9E798
Position
Unknown
AA seq 560 aa
MPIQIFCSVSFTSGEEAPGPLGDVWGPHQQQQQDNLESEEEKEEEKEKEAVKEEASEGDL
PMDLVAFANSSTLHGASHVFVEGGLGPRQALWAVAFVLALSAFLCQVGDRVAYYFSYPHV
TLLDEVATTELAFPAVTLCNTNAVRLSQLSYPDLLYLAPMLGLDESDDPGVPLAPPGPEA
FSGEPFNLHRFYNRSCHLLEDMLLYCSYRGGPCGPHNFSVVFTRYGKCYTFNSGRDGRPR
LKTMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPFIDQLGFGVA
PGFQTFVACQEQRLIYLPPPWGTCKAVTMDSDFFDSYSITACRIDCETRYLVENCNCRMV
HMPGDAPYCTPEQYKECADPALDFLVEKDQEYCVCEMPCNLTRYGKELSMVKIPSKASAK
YLAKKFNKSEQYIGENILVLDIFFEVLNYETIEQKKAYEIAGLLGDIGGQMGLFIGASIL
TVLELFDYAYEVIKHKLCRRGKCQKDAKRSSADKGVALSLDDVKRHNPCESLRGHPAGMT
YAANILPHHPARGTFEDFTC
NT seq 1683 nt   +upstreamnt  +downstreamnt
atgcccatccagatcttctgctctgtgtcattcacctctggagaggaggctccagggccc
ttgggagatgtttggggtccccaccagcagcagcaacaggataacttagaatctgaagag
gagaaagaagaggagaaggaaaaggaggcagtgaaggaggaagccagtgagggggatttg
cctatggacttggtggcctttgccaacagctccaccctccacggtgccagccatgtcttc
gtggaggggggtctagggccgaggcaggccctgtgggcggtggcctttgtcctggcactg
agtgccttcctgtgccaggtaggcgaccgtgttgcttattacttcagctacccacacgtg
actctgctagacgaggtggccaccacggagctggccttcccggcggtcaccctttgcaac
accaatgctgtgcggctgtctcagctcagctaccctgacttgctctacctggctcccatg
ctggggctggatgaaagtgatgaccctggggtgccccttgccccaccggggcctgaggcc
ttctctggggagccttttaacctgcaccgattctacaatcgctcctgccacctgctggag
gacatgctgctctattgctcctatcgcggggggccctgcggccctcataacttctcggtg
gtcttcacgcggtatgggaagtgctacacattcaactcaggccgagatgggcggccacgg
ctgaagaccatgaagggtgggacaggcaatgggctggagatcatgctggacatccagcag
gacgagtacctgcccgtgtggggggagactgatgagacgtcctttgaggcgggcatcaaa
gtacagatccacagtcaggatgaacctcctttcatcgaccagctgggttttggtgtggct
ccagggttccagaccttcgtggcctgccaggagcagcggctcatctacctgcccccaccc
tggggtacctgcaaagctgttaccatggactcggatttcttcgactcctacagcatcacc
gcctgccgcattgactgtgagacgcgctacctggtagagaattgcaactgccgcatggta
cacatgccaggggatgccccatactgcactccagagcagtacaaagagtgtgcagatcct
gctctggacttcctggtggaaaaggaccaagagtactgcgtgtgcgaaatgccctgcaac
ctgacccgctatggcaaggagctgtccatggtcaagatccccagcaaagcttcagccaag
tacctggccaaaaaattcaacaagtctgagcagtacataggggagaacatcctggtgctg
gacattttcttcgaagtcctcaactatgagaccattgagcagaagaaggcctatgagatt
gcagggctcctgggtgacattgggggccagatggggctgttcatcggcgccagcatcctc
acggtgctggagctctttgactacgcctacgaggtcattaagcacaagctgtgccggcga
gggaaatgccagaaggatgccaaaaggagcagtgcggacaagggggtggccctcagtctg
gacgacgtcaaaagacacaacccgtgcgagagcctccgtggccatcctgccgggatgact
tacgctgccaacatcctacctcaccatccggcccgaggcacgttcgaggactttacctgc
tga

DBGET integrated database retrieval system