KEGG   Trichechus manatus latirostris (Florida manatee): 101359133Help
Entry
101359133         CDS       T05135                                 

Definition
(RefSeq) biliverdin reductase A
  KO
K00214  biliverdin reductase [EC:1.3.1.24]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu00860  Porphyrin and chlorophyll metabolism
tmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    101359133
Enzymes [BR:tmu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.24  biliverdin reductase
     101359133
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Biliv-reduc_cat GFO_IDH_MocA NAD_binding_3
Motif
Other DBs
NCBI-GeneID: 101359133
NCBI-ProteinID: XP_023594086
UniProt: A0A2Y9RKH3
Position
Unknown
AA seq 296 aa AA seqDB search
MNVEPERKFGVVVVGVGKAGSVRIRDLRDPHASSAYLNLIGFVSRRELQSIDEVQQISLE
DALSSQEVEVAYICSESSSHEGYVRQFLNAGKHVLVEYPMTLSRAAAQELWELAEQKGKI
LHEEHVELLMEEFAFLKKEVVGKDLLKGSLLFTAGPLEEERFGFPAFSSISRLTWLVSLF
GELSLVSATLEERKEDQYMKMTVCLETENKRPLTWTEEKGPGLKRNRYLSFHFKSGSLEN
VPNVGINKNIFLKDQNIFVQKLLGQFSEKELAAEKKRILHCLGLAEEIQKHCRPEK
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaacgttgagcccgagagaaagtttggcgtggtggtggttggcgttggcaaagccggc
tctgtgcggataagggacttgcgggacccacatgcttcctcggcgtacctgaacctgatt
ggcttcgtgtccagacgagagctccagagcattgatgaagtccagcagatttctctggaa
gatgctctttccagccaagaggttgaggtggcctacatctgcagcgaaagttccagccac
gagggctacgtcaggcagttcctaaatgctggcaaacatgtcctcgtggaataccccatg
acactatctcgggcagcagctcaggaactctgggagctggctgagcagaaaggaaaaatc
ctacatgaggagcatgtggaacttttgatggaggagtttgcattcctgaaaaaagaagtg
gtggggaaggacttgttgaaaggatctctcctcttcacagctggccctttggaagaagag
cggtttggtttcccagcgttcagtagcatctctcgcctgacctggctggtctccctcttc
ggggagctttctctggtgtctgccactttggaagagagaaaggaagaccagtacatgaag
atgactgtgtgcctggagaccgagaacaaacgcccgctaacatggactgaagagaaaggg
cctggcctaaaacgcaacagatatttgagcttccatttcaagtctgggtccctggagaat
gtgcccaatgtaggaatcaataagaacattttcctgaaagatcaaaatatatttgtccaa
aaactcttgggccagttctctgagaaagagctggctgcagagaagaagcgcatcctgcac
tgcctggggcttgctgaggaaatccagaaacactgccgcccagagaaataa

DBGET integrated database retrieval system