KEGG   Trichechus manatus latirostris (Florida manatee): 101359207
Entry
101359207         CDS       T05135                                 

Definition
(RefSeq) 11-cis retinol dehydrogenase
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    101359207
Enzymes [BR:tmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     101359207
SSDB
Motif
Pfam: adh_short adh_short_C2 KR
Other DBs
NCBI-GeneID: 101359207
NCBI-ProteinID: XP_023590351
UniProt: A0A2Y9RA68
Position
Unknown
AA seq 318 aa
MWLPLLLGALVWGVLWLLRDQQTLPRSDAFIFITGCDSGFGRLLALRLDQQGFRVLASCL
TPAGAEDLQRMASSRLHTILLDVTDPQSVQWAAKWVKTQVGEAGLFGLVNNAGVAGIIGP
TPWLTWDDFHRVLSVNTLGPIGVTLALLPLLQEAHGRVVNVTSVLGRLAANGGGYCVSKF
GLEAFSDSLRRDMAPFGVRVSIVEPGFFRTPVTNLESLEGALQACWARLPSAMQAQYGEA
FLTKYLKVQQCIMNLLCDPDLTKVSRCLEHALTARHPRTRYSPGWDAKLLWLPASYLPAS
LVDAVLTWVLPKPAQAVS
NT seq 957 nt   +upstreamnt  +downstreamnt
atgtggcttcctctgctgctgggtgccttggtctggggagtgctgtggttgctccgggac
cagcagaccctgccccgcagcgatgccttcatcttcatcactggctgtgactcgggcttc
gggcggcttctggcactacgactggaccagcagggcttccgtgtcctggccagctgcctg
acccctgcaggggctgaggacctacagcggatggcctcctcccgccttcacaccatcctg
ctggatgtcactgatccccagagtgtccagtgggcagccaagtgggtgaagacacaggtt
ggggaagcagggctgtttggtctggtgaacaatgctggtgtggctggtatcattgggcct
acaccatggctgacatgggatgatttccaccgggtgctgagtgtgaacaccctgggtccc
atcggggtcacccttgccctactgcccctgttgcaagaggcccatggccgggtagtcaac
gtcaccagtgtcctgggtcgcctggcagccaatggcggcggctactgtgtctctaagttt
ggcctggaggccttctctgacagcctaaggcgggacatggctccttttggtgtaagggtc
tccatcgtggagcctggcttcttccgaacccccgtgaccaacctggagagtttggagggt
gccctgcaggcctgctgggcgcggcttccttctgccatgcaagcccagtatggagaggcc
ttcctcactaagtacctgaaagtacagcagtgtatcatgaacctgctctgtgacccggac
ctgaccaaggtgagcaggtgcctggagcatgccctgactgcccgtcacccccgaacccgc
tacagcccaggctgggatgccaagctgctctggctgccagcctcctacctaccagccagc
ctggtggatgctgtgctcacctgggtccttcccaagcctgcccaggcagtctcctga

DBGET integrated database retrieval system