KEGG   Thermotoga maritima MSB8: THMA_0883
Entry
THMA_0883         CDS       T03902                                 

Definition
(GenBank) preprotein translocase subunit SecF
  KO
K03074  preprotein translocase subunit SecF
Organism
tmw  Thermotoga maritima MSB8
Pathway
tmw03060  Protein export
tmw03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:tmw00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    THMA_0883
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    THMA_0883
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:tmw02044]
    THMA_0883
Secretion system [BR:tmw02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   THMA_0883
SSDB
Motif
Pfam: SecD_SecF Sec_GG DUF2922 Sterol-sensing
Other DBs
NCBI-ProteinID: AKE28640
UniProt: Q9WZW5 R4P1M7
Position
885093..885974
AA seq 293 aa
MRKEIDFMGKSKIFITISLILIAISIVSIFTKGFNFGVEFTGGSEIIVRFENKEVTENDI
RAAISQISEEFANARIVEVRSAGDPSNVQKYSIIVPKTYEPDEKQKIQEEMEKLLSGKVV
SFNEISGTAAEEIRRGTWTAILVALVVLLIYITIRFRFIFGVAAVVALIHDVLITMGFFS
LFGYEINVAAVAAFLTLLGYSLNDTIVLSDRIRENMRRYRGRNMVNIVNMSINQVLARTI
NTSLTTFFVVFVLLLFAGNAVKPFAFGMTVGTIVGTYSSLYVASPIIVKWTKQ
NT seq 882 nt   +upstreamnt  +downstreamnt
atgaggaaagaaattgatttcatgggaaagtcgaagatcttcattacgatctcgctgata
ctgatagcgatatccatcgtttccatattcacgaaaggattcaacttcggagtggagttc
accggtggttccgagatcatagtgagatttgaaaacaaagaggtcacggaaaacgacata
agggccgctatttctcaaatctctgaagaatttgcaaacgcgagaatagtagaagttcgt
tccgcgggagatccttcaaacgttcagaagtactccattatcgttccgaaaacttacgaa
ccggatgaaaagcagaaaattcaggaagagatggaaaagctcctttcgggcaaggtggtg
tccttcaatgagatcagtggaacagcagctgaggaaatcagaaggggaacgtggacggcg
attctggtggctcttgttgtgctcctcatctacataaccatcagattcagattcatcttt
ggagtcgccgctgttgtggctctgatacacgatgtgctcatcaccatgggattcttctcg
ctgttcggctacgagataaacgtcgcggcggtggcagcgtttctcacactactcggttac
tctctcaacgacacgatcgttctttcagacaggatcagggagaacatgagaagatatcgc
ggaaggaacatggtgaacatcgtgaacatgagtataaatcaggtgctcgccagaacgata
aacacctctctcaccacgttcttcgtcgtttttgttcttcttctgtttgctggaaacgcc
gtcaaacccttcgctttcggaatgacggtgggtacgattgtgggaacgtattcctcgctt
tacgttgcctcgcctatcatcgtgaaatggacaaaacaataa

DBGET integrated database retrieval system