KEGG   Thermotoga maritima MSB8: THMA_1120Help
Entry
THMA_1120         CDS       T03902                                 

Definition
(GenBank) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
tmw  Thermotoga maritima MSB8
Pathway
tmw00220  Arginine biosynthesis
tmw01100  Metabolic pathways
tmw01110  Biosynthesis of secondary metabolites
tmw01130  Biosynthesis of antibiotics
tmw01230  Biosynthesis of amino acids
Module
tmw_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:tmw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    THMA_1120
Enzymes [BR:tmw01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     THMA_1120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N
Motif
Other DBs
NCBI-ProteinID: AKE28873
UniProt: G4FEQ0
Structure
PDB: 

Position
1114948..1115889
Genome map
AA seq 313 aa AA seqDB search
MSVNLKGRSLLTLLDFSPEEIRYLLDISKQVKMENRSKLRTERFKGMTLAMIFEKRSTRT
RLAFETAFAEEGGHPIFLSPNDIHLGAKESLEDTARVLGRMVDAIMFRGYKQETVEKLAE
YSGVPVYNGLTDEFHPTQALADLMTIEENFGRLKGVKVVFMGDTRNNVATSLMIACAKMG
MNFVACGPEELKPRSDVFKRCQEIVKETDGSVSFTSNLEEALAGADVVYTDVWASMGEED
KEKERMALLKPYQVNERVMEMTGKSETIFMHCLPAVKGQEVTYEVIEGKQSRVWDEAENR
KHTIKAVMIATLL
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
gtgtctgtgaatctgaaagggagatctcttctcactcttcttgatttttctcctgaagag
atcagataccttctcgatatctcaaagcaggtgaagatggagaacagatccaaactgaga
accgaaaggttcaaaggaatgaccctcgccatgatcttcgagaaacgatcaacgagaacg
agactcgcctttgaaaccgcttttgcagaagaaggaggacatccgatctttctttcaccg
aacgacatacaccttggagcaaaagaatctctcgaggacaccgcacgcgtccttggaaga
atggtggacgccatcatgttcaggggctacaaacaggagactgtggaaaagctggctgag
tactccggtgttcccgtgtacaacggactcaccgacgagttccacccaacgcaggcgctc
gccgacctgatgaccatagaggaaaattttggcagattgaagggtgtaaaggttgttttc
atgggggacaccagaaacaacgttgcgacctccctcatgatcgcctgtgcgaagatgggg
atgaatttcgtggcgtgtggtcccgaagaactcaagcccagatctgacgtattcaaaagg
tgccaagaaatagtgaaagaaaccgatgggagcgtttctttcacatcgaatctggaagaa
gcactcgcaggtgccgatgtcgtctacacagacgtgtgggcatccatgggtgaggaagac
aaagaaaaggagagaatggctcttttaaaaccttatcaggtgaacgagagagtgatggaa
atgacgggtaaatcggaaacgattttcatgcactgcctccccgcggtgaagggccaggag
gtcacctacgaggtaatcgagggaaaacagagcagggtctgggacgaggcggagaataga
aagcacaccataaaagcggtcatgatagcaacactgctgtga

DBGET integrated database retrieval system