KEGG   Thermotoga maritima MSB8: THMA_1661
Entry
THMA_1661         CDS       T03902                                 

Definition
(GenBank) alkylhydroperoxidase
Organism
tmw  Thermotoga maritima MSB8
SSDB
Motif
Pfam: CMD
Other DBs
NCBI-ProteinID: AKE29379
UniProt: Q9X1V5 R4P3Q6
Structure
PDB: 
1VKE 1P8C

Position
complement(1608373..1608738)
AA seq 121 aa
MEYKKFVEARRELNEKVLSRGTLNTKRFFNLDSAVYRPGKLDVKTKELMGLVASTVLRCD
DCIRYHLVRCVQEGASDEEIFEALDIALVVGGSIVIPHLRRAVGFLEELREMEKNGETIS
L
NT seq 366 nt   +upstreamnt  +downstreamnt
gtggagtacaaaaagtttgtggaagcaagaagagagctgaacgagaaggtgttatcccgt
ggaactctgaacacgaagagattcttcaatctcgactccgccgtttacaggcccgggaaa
ctcgatgtaaagaccaaagaactgatggggctcgtagcatccacggttctcaggtgcgat
gattgtataaggtaccaccttgtaaggtgtgttcaggaaggagcgagcgacgaagagatc
ttcgaagcccttgacatcgccctcgtggttggtggctctatcgtgataccgcacttgaga
agagctgtgggattccttgaagagctgagggagatggagaaaaatggcgagactatttct
ctttga

DBGET integrated database retrieval system