KEGG   Thermotoga maritima MSB8: THMA_1786Help
Entry
THMA_1786         CDS       T03902                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
tmw  Thermotoga maritima MSB8
Pathway
tmw00260  Glycine, serine and threonine metabolism
tmw01100  Metabolic pathways
tmw01110  Biosynthesis of secondary metabolites
tmw01120  Microbial metabolism in diverse environments
tmw01130  Biosynthesis of antibiotics
tmw01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tmw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    THMA_1786
Enzymes [BR:tmw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     THMA_1786
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Cys_Met_Meta_PP OKR_DC_1 Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AKE29499
UniProt: R4NTX8 Q9X266
Structure
PDB: 

Position
1719948..1720979
Genome map
AA seq 343 aa AA seqDB search
MIDLRSDTVTKPTEEMRKAMAQAEVGDDVYGEDPTINELERLAAETFGKEAALFVPSGTM
GNQVSIMAHTQRGDEVILEADSHIFWYEVGAMAVLSGVMPHPVPGKNGAMDPDDVRKAIR
PRNIHFPRTSLIAIENTHNRSGGRVVPLENIKEICTIAKEHGINVHIDGARIFNASIASG
VPVKEYAGYADSVMFCLSKGLCAPVGSVVVGDRDFIERARKARKMLGGGMRQAGVLAAAG
IIALTKMVDRLKEDHENARFLALKLKEIGYSVNPEDVKTNMVILRTDNLKVNAHGFIEAL
RNSGVLANAVSDTEIRLVTHKDVSRNDIEEALNIFEKLFRKFS
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatctcaggtccgacaccgttacaaaaccaacagaagagatgagaaaagccatg
gcacaggctgaggtgggagacgatgtgtacggagaagatccaaccatcaacgaactcgaa
aggctcgccgcagagacctttggaaaggaagcggctctctttgtaccctccggcaccatg
ggaaatcaagtgagcataatggctcacacccagaggggcgatgaagtgatactggaggca
gacagccacatcttctggtacgaggtcggagccatggcggttctctccggagtcatgccc
catcctgtacctggaaaaaatggagccatggaccccgatgatgtgaggaaggccataaga
cccagaaacatacacttccccagaacttcgctcattgccatcgaaaacacacacaaccgt
tccggtggaagagtggtcccgcttgaaaacataaaagagatttgcacgatagccaaagaa
cacggcataaacgttcacatagatggtgcgaggatcttcaacgcctcaatcgcttcaggt
gttcccgtgaaggagtacgccgggtacgccgattccgtgatgttctgtctttcaaaaggt
ctctgcgcacccgtcggttcggtggttgtaggagacagggacttcatagaaagagcgaga
aaggcgagaaagatgctcggtggagggatgagacaggcaggtgttctcgctgccgctgga
ataatcgccttgacaaagatggtagatcgattgaaagaagatcatgaaaacgccagattt
ctcgccctgaagttgaaagaaatagggtactccgtgaatcccgaagatgtgaaaaccaac
atggtgattctgaggaccgacaacctgaaggtgaacgcgcacgggttcatagaagcgctc
agaaacagcggggtgctcgcgaacgccgtatccgacacggagatcagactggtaacccac
aaagacgtttcaagaaacgacatagaagaggctctgaacatcttcgaaaaactcttcaga
aaattctcctga

DBGET integrated database retrieval system