KEGG   Thermotoga maritima Tma200: THMC_0268Help
Entry
THMC_0268         CDS       T03901                                 

Definition
(GenBank) phosphate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
tmx  Thermotoga maritima Tma200
Brite
KEGG Orthology (KO) [BR:tmx00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    THMC_0268
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AKE26200
Position
270340..271548
Genome map
AA seq 402 aa AA seqDB search
MTILIIAGILGFIMAFSIGANDVANSMATAVGARAITVRQAALIAMFLEFLGAVMFGSHV
SQTIVKGIVEVEKVQPVELMYGALSALIAASFWILIATNWGYPVSTTHSIVGGMMGFGLV
AVGINGVNWKTFLFIVLSWVVSPVLGGLISFVMFKLISLSVFHTKNPKKSSTVAIPFFIS
LAIFTMISLFVKKTLKQPLSESFLLGIAFSLVTFFVVHFAVRKLINEKKDVYDAVENVFK
RAQILTSCYVSFSHGANDVANAAGPVAAVMIVASTGVVPKTVEIPFLALLLGGIGISLGV
FFLGQKVMETVGEKITTLTNSRGFTVDFSTATTVLLASSLGLPISTTHVVVGAVTGVGFA
RGLEMVNVGVLKNIVISWLLIVPTVAATSAAVYWVLKLILKF
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
gtgacaatactcatcatagctggcatacttggtttcatcatggctttctccataggagcc
aacgatgtggcgaactccatggcgacagctgttggggcaagggctataactgtgagacag
gcagctcttatagcgatgtttctcgagtttcttggagcagttatgttcggctcccatgtc
tcccagacgatcgtcaaaggaatagtggaagtggagaaagttcaaccggtagaactcatg
tatggtgcactgtcagccttgatcgcagcttcattctggattctgatagcgaccaactgg
ggttatcccgtttccaccacccattctatagtcggaggaatgatgggattcggtcttgtg
gcggtgggtataaatggcgtgaactggaaaacgtttctcttcatagtactttcctgggtt
gtttcacctgttctcggcggtttgatttcctttgtgatgttcaaactgatctctctttcg
gtgttccacacaaaaaatccgaagaaatcttccactgtcgctattccgtttttcatatct
cttgcgattttcacaatgatatctctttttgtaaaaaagacgctcaaacagcctctcagt
gaatcttttctgctcggtatcgctttctctctcgtaacattttttgtggttcacttcgct
gtgagaaagttgataaacgaaaagaaagatgtgtacgatgcggttgaaaatgtgttcaag
cgcgctcagattctcacttcatgctacgtttctttttctcatggagccaacgacgttgcc
aacgcggcgggccctgtagcggcggtcatgatcgttgcgtcaacgggtgttgttccaaaa
accgtcgagattccgtttctggcgcttcttcttgggggaatcggtatctcgctcggtgtg
ttcttccttggacagaaggtcatggaaacggtgggtgaaaagataactacgctcacaaat
tccaggggattcacagtggatttttccactgcgacgacggttctactcgcttcgtcacta
gggcttcctatctccacgacacacgttgtggtgggagctgtcacgggtgttggcttcgcc
agagggcttgagatggtgaacgttggtgtgttgaagaacatcgttatatcctggcttctc
atagtaccaacggtggctgcgacttccgcggctgtctattgggttttgaaactgatacta
aaattctaa

DBGET integrated database retrieval system