KEGG   Thauera sp. MZ1T: Tmz1t_0793Help
Entry
Tmz1t_0793        CDS       T00804                                 

Definition
(GenBank) sulfate adenylyltransferase, large subunit
  KO
K00956  sulfate adenylyltransferase subunit 1 [EC:2.7.7.4]
Organism
tmz  Thauera sp. MZ1T
Pathway
tmz00230  Purine metabolism
tmz00261  Monobactam biosynthesis
tmz00450  Selenocompound metabolism
tmz00920  Sulfur metabolism
tmz01100  Metabolic pathways
tmz01110  Biosynthesis of secondary metabolites
tmz01120  Microbial metabolism in diverse environments
tmz01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tmz00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    Tmz1t_0793
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Tmz1t_0793
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Tmz1t_0793
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    Tmz1t_0793
Enzymes [BR:tmz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.4  sulfate adenylyltransferase
     Tmz1t_0793
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU MMR_HSR1 GTP_EFTU_D2 GTP_EFTU_D3
Motif
Other DBs
NCBI-ProteinID: ACK53562
UniProt: C4ZJ49
Position
complement(876107..877387)
Genome map
AA seq 426 aa AA seqDB search
MSALEHLPEIDNGLLRFLTCGSVDDGKSTLIGRLLFDTKTILADTLNAIEKTSAKRGMSA
VDLSLLTDGLQAEREQGITIDVAYRYFSTGRRKYIIADAPGHEQYTRNMVTAASTANLAI
ILIDARKGVLTQTRRHSYLASLVGIPHLVVAVNKMDLVDYDQAVFERIKGEYLEFAAKLG
IRDVRFIPISALEGDMIVDRGERLSWYDGPTLLDILENAPAAHTEQAEDFRFPVQFVCRP
QESANPELHDYRGFMGRVESGEVAVGDAVTVLPSGASSRVRKIELGGVALPRAIHEQSVT
LLLEDEIDISRGDLIVKSAEAREPVKQIEATVCWLSETPLSPARTYLVRHTTREVKAKLA
KIDYRLDVNTLEQEATTGLAMNDIARVTLKLAQPIIADRYTENRATGAFIIIDESTNNTV
GAGMIG
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccctcgagcacctccccgaaatcgacaacggcttgctgcgctttctcacctgc
ggcagcgtcgacgacggcaagagcaccctgatcggccgcctgctgttcgacaccaagacc
atcctcgccgacaccctcaacgccatcgagaagacctcggccaagcgcggcatgagcgcg
gtcgacctgtcgctgctgaccgatggcctgcaggccgagcgcgagcagggcatcaccatc
gacgtcgcctaccgctacttctccaccgggcggcgcaagtacatcatcgccgacgccccc
ggccacgagcagtacacccgcaacatggtgaccgccgcgtccaccgccaacctggcgatc
atcctcatcgacgcgcgcaagggcgtgctgacccagacccgccgccactcctacctcgcc
agcctggtcggcattccccatctggtggtcgcggtcaacaagatggacctggtcgactac
gaccaggcggtgttcgagcgcatcaagggggaatacctcgaattcgccgccaagctcggc
atccgggacgtgcgcttcatcccgatctcggcgctggagggcgacatgatcgtcgaccgc
ggcgagcgcctgtcctggtacgacggcccgaccctgctcgacatcctcgagaacgccccc
gcagcccacaccgaacaggccgaggacttccgcttcccggtgcagttcgtgtgccgaccg
caagagtccgccaaccccgaactgcacgactatcgcggcttcatgggccgggtcgaatcg
ggcgaggtcgcggtgggcgacgcggtcaccgtactgccctcgggcgccagcagccgggtc
aggaagatcgagctcggcggcgtcgcgctgccgcgcgccatccacgagcagtcggtgacc
ctgctgctcgaagacgagatcgacatctcgcgcggcgacctgatcgtgaaatccgccgag
gcgcgggagccggtcaagcagatcgaagccacggtgtgctggctgtccgagaccccgctg
tcgcctgcacgcacctacctggtacgccacaccacgcgcgaggtgaaggccaagctcgcg
aagatcgactaccgcctggacgtgaataccctggaacaggaggccaccaccgggctggcg
atgaacgacatcgcccgcgtcacgctcaagctcgcccagccgatcatcgccgaccgctac
acggagaaccgcgctaccggcgccttcatcatcatcgacgagagcaccaacaacaccgta
ggcgcgggcatgatcggctga

KEGG   Thauera sp. MZ1T: Tmz1t_0794Help
Entry
Tmz1t_0794        CDS       T00804                                 

Definition
(GenBank) sulfate adenylyltransferase, small subunit
  KO
K00957  sulfate adenylyltransferase subunit 2 [EC:2.7.7.4]
Organism
tmz  Thauera sp. MZ1T
Pathway
tmz00230  Purine metabolism
tmz00261  Monobactam biosynthesis
tmz00450  Selenocompound metabolism
tmz00920  Sulfur metabolism
tmz01100  Metabolic pathways
tmz01110  Biosynthesis of secondary metabolites
tmz01120  Microbial metabolism in diverse environments
tmz01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tmz00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    Tmz1t_0794
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Tmz1t_0794
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Tmz1t_0794
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    Tmz1t_0794
Enzymes [BR:tmz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.4  sulfate adenylyltransferase
     Tmz1t_0794
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PAPS_reduct ATP_bind_3
Motif
Other DBs
NCBI-ProteinID: ACK53563
UniProt: C4ZJ50
Position
complement(877464..878378)
Genome map
AA seq 304 aa AA seqDB search
MSTLTKQTLSHLDWLEAEAIHILREVAGQCANPVLLFSGGKDSICLLRLAEKAFRPGRFP
FPLMHIDTGHNYKEVTDFRDRRAAELGERLIVRSVEDSMARGTVVLKHAGESRNKHQSVT
LLEAIEEFGFDACIGGARRDEEKARAKERIMSFRDEFGQWDPKNQRPELWNLYNARSHKG
ENIRAFPISNWTELDVWQYIQREQLELPSIYFAHTRPVVRKNGLLQPVTELTPAKDGDVV
EDVRVRFRTVGDITCTAPVESDADTVEKILAETATTTITERGATRMDDQTSEASMEQRKK
EGYF
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgtccacgctgaccaaacagacgctgtcccacctcgactggctcgaggccgaagccatc
cacatcctgcgcgaagtcgccggccagtgcgccaacccggtgttgctgttctccggcggc
aaggattcgatctgcctgctgcgcctggccgagaaggcctttcgcccgggccgcttcccc
ttcccgctgatgcacatcgacaccggccacaactacaaggaagtcaccgacttccgcgac
cggcgcgccgccgaactgggcgagcgcctgatcgtgcgctcggtggaagactcgatggcg
cgcggcaccgtggtgctgaagcacgcgggcgagtcgcgcaacaagcaccagtcggtgacg
ctgctcgaggcgatcgaggagttcggcttcgacgcctgcatcggcggcgcccgccgcgac
gaggagaaggcgcgtgccaaggaacgcatcatgagcttccgcgacgagttcgggcagtgg
gacccgaagaaccagcgtcccgagctgtggaacctgtacaacgcgcgtagccacaagggc
gagaacatccgcgccttcccgatcagcaactggaccgaactcgacgtgtggcagtacatc
cagcgcgagcagctggaactgccatcgatctacttcgcccacacccgcccggtggtgcgc
aagaacggcctgctgcagccggtgaccgagctgacgccggcgaaggatggcgacgtcgtg
gaggacgtgcgggtgcgcttccgcaccgtgggggacatcacctgcacggcgccggtggaa
tccgacgcggacaccgtggagaagatcctcgccgagacggcgaccaccacgatcaccgag
cgcggtgcgacgcggatggacgaccagacctcggaggcgtcgatggagcaacgcaagaag
gaaggctacttctga

KEGG   Thauera sp. MZ1T: Tmz1t_1397Help
Entry
Tmz1t_1397        CDS       T00804                                 

Definition
(GenBank) sulfate adenylyltransferase, small subunit
  KO
K00957  sulfate adenylyltransferase subunit 2 [EC:2.7.7.4]
Organism
tmz  Thauera sp. MZ1T
Pathway
tmz00230  Purine metabolism
tmz00261  Monobactam biosynthesis
tmz00450  Selenocompound metabolism
tmz00920  Sulfur metabolism
tmz01100  Metabolic pathways
tmz01110  Biosynthesis of secondary metabolites
tmz01120  Microbial metabolism in diverse environments
tmz01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tmz00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    Tmz1t_1397
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Tmz1t_1397
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Tmz1t_1397
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    Tmz1t_1397
Enzymes [BR:tmz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.4  sulfate adenylyltransferase
     Tmz1t_1397
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PAPS_reduct
Motif
Other DBs
NCBI-ProteinID: ACK54156
UniProt: C4ZNJ3
Position
1555592..1556509
Genome map
AA seq 305 aa AA seqDB search
MTSVPTTSLTHLQRLEAESIHILREVVAEADNPVMLYSIGKDSAVMLHLALKAFHPAVPP
FPLLHVDTRWKFRDMYSFRDRMAGETGMDLLVHINPEGVEKDINPFTHGSAIHTDIMKTE
GLKQALDQYGFDVAFGGARRDEEKSRAKERVFSFRTAQHRWDPKNQRPELWKLYNARKHK
GESIRVFPLSNWTELDIWQYIYLENIPIVPLYYAAVRPVVERDGTLIMVDDERMPLRPGE
VPMMKKVRFRTLGCYPLTGAIESEADTLPAIIQEMLLARTSERQGRVIDHDSAASMEKKK
QEGYF
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcgtgcctacgaccagcctgacccacctccagcgcctcgaagccgagagcatc
cacatcctgcgcgaggtcgtcgccgaggccgacaacccggtgatgctctactccatcggc
aaggacagcgcggtgatgctgcacctggccctgaaggccttccatccggcggtgccgccc
tttccgctgctgcacgtcgatacgcgctggaagttccgcgacatgtacagctttcgcgac
cgcatggcgggcgagaccggcatggacctgctggtgcacatcaaccccgagggcgtggag
aaggacatcaacccctttacccacggctcggcgatccacaccgacatcatgaagaccgag
ggcctcaagcaggcgctcgaccagtacggcttcgacgtggccttcggcggcgcgcgccgc
gacgaggagaaatcgcgcgccaaggagcgcgtgttctccttccgcaccgcgcagcaccgc
tgggacccgaagaaccagcgccccgagctgtggaagctctacaacgcgaggaagcacaag
ggcgagtcgatccgcgtgttccccctgtcgaactggaccgagctcgacatctggcagtac
atctacctcgagaacatccccatcgtgccgctctactacgccgcggtgcgcccggtggtc
gagcgcgacggcacgctgatcatggtcgacgacgagcgtatgccgctgcgcccgggcgag
gtgccgatgatgaagaaggtgcgcttccgcactctgggctgctatccgctcaccggcgcg
atcgagtccgaggccgacaccctgccggcgatcatccaggagatgctgctggccaggacc
tcggagcgccaggggcgggtgatcgaccacgactcggccgcctcgatggaaaagaaaaag
caggagggctatttctaa

KEGG   Thauera sp. MZ1T: Tmz1t_1398Help
Entry
Tmz1t_1398        CDS       T00804                                 

Definition
(GenBank) sulfate adenylyltransferase, large subunit
  KO
K00955  bifunctional enzyme CysN/CysC [EC:2.7.7.4 2.7.1.25]
Organism
tmz  Thauera sp. MZ1T
Pathway
tmz00230  Purine metabolism
tmz00261  Monobactam biosynthesis
tmz00450  Selenocompound metabolism
tmz00920  Sulfur metabolism
tmz01100  Metabolic pathways
tmz01110  Biosynthesis of secondary metabolites
tmz01120  Microbial metabolism in diverse environments
tmz01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tmz00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    Tmz1t_1398
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Tmz1t_1398
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Tmz1t_1398
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    Tmz1t_1398
Enzymes [BR:tmz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.25  adenylyl-sulfate kinase
     Tmz1t_1398
   2.7.7  Nucleotidyltransferases
    2.7.7.4  sulfate adenylyltransferase
     Tmz1t_1398
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: APS_kinase GTP_EFTU MMR_HSR1 GTP_EFTU_D2 RsgA_GTPase AAA_33 AAA_18 GTP_EFTU_D4 SRPRB AAA_16 FeoB_N ABC_tran Zeta_toxin
Motif
Other DBs
NCBI-ProteinID: ACK54157
UniProt: C4ZNJ4
Position
1556510..1558429
Genome map
AA seq 639 aa AA seqDB search
MAHVSDLIATDIEQYLRAHENKSLLRFITCGSVDDGKSTLIGRLLYESKMLFEDQLAAVE
ADSKKYGTQGEAIDFALLVDGLAAEREQGITIDVAYRFFSTDKRKFIVADTPGHEQYTRN
MVTGASTADAAILMVDARKGILTQTRRHSYLVNLIGIRHIVVAINKMDLVDYAEGVFRRI
VEDYTAFSRQLGIEQVTFIPMSAFRGDNITSPSAAMPWYHGTTLMGYLETVEVDDGLMQR
APFRLPVQWVNRPNLDFRGFAGSIAGGTIRPGDRVRVQPSGRESTVARIVTRDGDLDRAV
AGQSVTLTLADEIDISRGDVISTVEAPAEVADQFECTVVWMHDEPMLAGRPYLLKIGART
VSATITEIKYQVNVNTLEHVAAKRLELNAIGVCNLSLDRPIAFDPYRINRDTGGFILIDR
LSNNTVGAGLLHFALRRAHNIHLQHVDVDKRARAALKNQRGCVLWFTGLSGAGKSSIANL
VEKKLHALGHHTYLLDGDNVRHGLNKDLGFTDADRVENIRRVAEVAKLMVDAGLIVLTAF
ISPFRSERRMARGLVEEGEFVEVFVDTPLEVAEARDPKGLYKKARRGELKNFTGIDSPYE
ASEDPELRLDTTRLDLEAAADAVLAWLGERGMLSRTPGG
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atggcacacgtttccgacctgatcgcgaccgacatcgagcagtacctcagggcgcacgag
aacaagagcctgctgcgcttcatcacctgcggcagcgtggacgacggcaagagcacgctg
atcgggcgcctgctctacgagtcgaagatgctcttcgaggaccagctcgccgcggtcgag
gccgactcgaagaagtacggcacccagggcgaggcgatcgacttcgcgctgctggtcgac
ggcctggccgccgagcgcgagcagggcatcacgatcgacgtggcgtatcgcttcttctcc
accgacaagcgcaagttcatcgtcgccgacacccccggccacgagcaatacacccgcaac
atggtcaccggcgcctcgacggccgacgcggccatcctgatggtcgatgcgcgcaagggc
atcctcacccagacgcggcgtcacagctacctggtgaacctcatcggcatccgccacatc
gtggtggcgatcaacaagatggacctggtcgattacgccgagggcgtgttccgccgcatc
gtcgaggactacaccgccttctcccgccagctcggcatcgagcaggtgaccttcatcccg
atgtcggccttcaggggcgacaacatcacctctccgagcgctgcgatgccctggtaccac
ggcaccacgctgatgggctacctcgagacggtggaggtcgatgacggcctgatgcagcgc
gcgcccttccgcctgccggtgcagtgggtcaatcgccccaacctggatttccgcggcttt
gccggctccatcgccggcggcaccatccgcccgggcgatcgtgtgcgcgtacagccctcg
gggcgcgagagcacggtggcgcgcatcgtgacccgcgacggcgatctcgaccgggccgtg
gccgggcagtcggtcacgctgaccctcgccgacgagatcgacatctcgcgcggcgacgtc
atctcgaccgtcgaggcgccggccgaggtcgccgaccagttcgagtgcacggtggtgtgg
atgcacgacgagcccatgctcgccggccgcccttacctgctcaagatcggcgcgcgcacg
gtcagcgcgacgatcaccgagatcaagtaccaggtgaatgtgaacaccctcgagcacgtc
gccgccaagcggctcgagctcaacgcgatcggcgtgtgcaacctgagcctggatcggccg
atcgccttcgatccctaccggatcaaccgcgacaccggcggcttcatcctgatcgaccgc
ctctccaacaacaccgtcggcgccggcctgttgcacttcgcgctgcgtcgcgcgcacaac
atccacctgcagcacgtcgatgtggacaagcgcgcgcgtgccgcgctgaagaaccagcgc
ggctgcgtgctgtggttcaccggcctgtccggcgcagggaagtcctcgatcgccaacctg
gtcgagaagaaactgcacgcgctcggccaccacacctacctgctcgacggcgacaatgtg
cgccatggcctcaacaaggacctcggcttcaccgacgccgatcgcgtggagaacatccgt
cgcgtcgccgaggtcgcgaagctgatggtcgatgcaggcctgatcgtgctcaccgccttc
atctcgcctttccgctccgagcgccgcatggcgcgcggcctggtggaggagggcgagttc
gtcgaggtcttcgtcgacactccgctggaggtggccgaggcgcgcgatcccaagggcctg
tacaagaaggcccggcgcggcgagctgaagaacttcaccggcatcgattcgccttacgag
gcgtcggaggaccccgaactgcgcctcgataccacccgcctcgacctggaggccgcggcc
gatgcggtgcttgcctggctgggcgagcgcggcatgctgagccggacgccggggggctga

DBGET integrated database retrieval system