KEGG   Thauera sp. MZ1T: Tmz1t_0806Help
Entry
Tmz1t_0806        CDS       T00804                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
tmz  Thauera sp. MZ1T
Pathway
tmz00071  Fatty acid degradation
tmz00072  Synthesis and degradation of ketone bodies
tmz00280  Valine, leucine and isoleucine degradation
tmz00310  Lysine degradation
tmz00362  Benzoate degradation
tmz00380  Tryptophan metabolism
tmz00620  Pyruvate metabolism
tmz00630  Glyoxylate and dicarboxylate metabolism
tmz00640  Propanoate metabolism
tmz00650  Butanoate metabolism
tmz00900  Terpenoid backbone biosynthesis
tmz01100  Metabolic pathways
tmz01110  Biosynthesis of secondary metabolites
tmz01120  Microbial metabolism in diverse environments
tmz01130  Biosynthesis of antibiotics
tmz01200  Carbon metabolism
tmz01212  Fatty acid metabolism
tmz02020  Two-component system
Brite
KEGG Orthology (KO) [BR:tmz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Tmz1t_0806
   00630 Glyoxylate and dicarboxylate metabolism
    Tmz1t_0806
   00640 Propanoate metabolism
    Tmz1t_0806
   00650 Butanoate metabolism
    Tmz1t_0806
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Tmz1t_0806
   00072 Synthesis and degradation of ketone bodies
    Tmz1t_0806
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Tmz1t_0806
   00310 Lysine degradation
    Tmz1t_0806
   00380 Tryptophan metabolism
    Tmz1t_0806
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Tmz1t_0806
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Tmz1t_0806
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Tmz1t_0806
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tmz04147]
    Tmz1t_0806
Enzymes [BR:tmz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Tmz1t_0806
Exosome [BR:tmz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Tmz1t_0806
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ACK53575
UniProt: C4ZJ62
Position
891530..892882
Genome map
AA seq 450 aa AA seqDB search
MNATARHSDGKRSRPAGKKEGSAVPKPIYIVDYARTPFLKAKNAPGPFTASDLATAAGSA
LLMRQPFAPDQLDEVILGCASPSADEVNIGRVVALRLGCGNKVPGWTVMRNCASGMQAID
SAIANLQCGRSQLVLAGGVDALSHAPLLFSEKMVRWLAGWYAARSTGDRLAMLKTFRLGH
LAPVIGIMKGLTDPIVGQLMGQTAENLAWKFGITREDMDAFAVESHRRVCAGQDAGHYAD
EIVPLIDRDGQVYAADDGVRRDSSMANLARLKPFFDRKYGRVTPGNSSQITDGAAWLVLA
SQEAVERHGLQPLGRIVDSQWAGLAPDQMGLGPVHATMPILQRHDLAPDDLDAWELNEAF
AAQVIACLRAFADDGYCRTHFGVDAPGAPDAARLNVDGGAVALGHPVGASGARIVLHLLE
VLRRKGGGRGLASICIGGGQGGAMLVETVR
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcgaccgcacggcattccgacgggaagcgctcgcgtcccgcagggaaaaaggaa
ggtagcgcggtgccaaagccgatctacatcgtcgattacgcacgtacgcccttcctgaag
gcgaagaacgcgcccggcccctttaccgcgtccgatctcgccaccgcggcgggtagcgcg
ctgctgatgcgccagcccttcgcgcccgaccagctcgacgaggtcatcctcggctgcgcc
agcccctccgcggacgaggtcaacatcggccgcgtggtcgcgctgcgcctggggtgcggc
aacaaggtgccggggtggacggtgatgcgcaactgcgcctcgggcatgcaggcgatcgac
tccgcgatcgccaacctccagtgcggccgcagccagctcgtgctcgccggcggcgtcgat
gcactctcgcacgcgccgctgctgttctccgagaagatggtgcgctggctcgccggctgg
tacgcggcgcgcagcaccggcgacaggctggcgatgctgaagaccttccgcctcggccat
ctcgccccggtgatcggcatcatgaagggcctcaccgacccgatcgtcggccagctgatg
ggccagaccgccgagaacctggcatggaagttcggcatcacgcgcgaagacatggacgcc
ttcgcggtcgagagccaccgccgcgtgtgcgccgggcaggacgccgggcactacgccgac
gagatcgtcccgctgatcgaccgcgacggccaggtgtacgcggccgacgacggcgtgcgg
cgcgactcctcgatggccaacctcgccaggctgaagccctttttcgacaggaaatacggc
cgtgtcaccccgggcaacagctcgcagatcaccgacggcgccgcctggctggtgctggcc
tcgcaggaggcggtcgagcgccacgggctgcagccgctcgggcgcatcgtcgacagccaa
tgggcgggtctcgcgcccgaccagatggggctcggtccggtgcacgccacaatgcccatc
ctgcagcgccatgatctggcgcccgacgacctcgacgcctgggagctcaacgaggccttc
gcagcgcaggtcatcgcctgcctgcgcgccttcgcggacgacggctactgccgcacgcac
ttcggcgtcgatgcgccgggtgcgcccgatgccgcgcggctgaacgtggatggcggcgcg
gtcgcgctcggccacccggtcggggcgagcggtgcgcgcatcgtgcttcatctgctcgaa
gtattgcgccgcaagggcggcgggcgcggcctggcgtcgatctgcatcggcggcgggcag
ggcggggcgatgctggtggagacggtgcgatga

DBGET integrated database retrieval system