KEGG   Thauera sp. MZ1T: Tmz1t_1446Help
Entry
Tmz1t_1446        CDS       T00804                                 

Definition
(GenBank) Cystathionine gamma-lyase
  KO
K01739  cystathionine gamma-synthase [EC:2.5.1.48]
Organism
tmz  Thauera sp. MZ1T
Pathway
tmz00270  Cysteine and methionine metabolism
tmz00450  Selenocompound metabolism
tmz00920  Sulfur metabolism
tmz01100  Metabolic pathways
tmz01110  Biosynthesis of secondary metabolites
tmz01130  Biosynthesis of antibiotics
tmz01230  Biosynthesis of amino acids
Module
tmz_M00017  Methionine biosynthesis, apartate => homoserine => methionine
Brite
KEGG Orthology (KO) [BR:tmz00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    Tmz1t_1446
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Tmz1t_1446
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Tmz1t_1446
Enzymes [BR:tmz01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.48  cystathionine gamma-synthase
     Tmz1t_1446
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP Aminotran_1_2 Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ACK54205
UniProt: C4ZNP2
Position
complement(1612156..1613304)
Genome map
AA seq 382 aa AA seqDB search
MQHDAKLSPATLAAQGTGATPMPHRDIVPPIHLATTFERAEDGSLPGGRIYARDASPAYD
PAEALLCELEGGARAALFASGMAAASAVLLALKPGARIVAPHDMYWSLRNWMIGFAANWQ
IALDFYADAAELAALLQRPADLVWVETPANPTWEILDIARAAELAHAAGARLVVDSTVPT
PVFTRPLALGADVVMHSATKYLNGHSDVVAGVLVTRAEDDFWARIKTARAAGGAVLGPFE
AWLLNRGLRTLFPRVRTAAASALRIAQHFEHHPALLAVLYPGLPSHRGHDIACRQMEGGF
GAMLSLRVRGGEDAARRVAGAVKIFRRATSLGSVESLIEHRGPIEGPGTRCPLDLLRLSV
GIEDSDDLIADLEQALQQANEP
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgcagcacgacgccaagctctcccctgccaccctcgccgcccagggcacgggcgccacc
ccgatgccgcaccgcgacatcgtgccgccgatccacctggcgaccaccttcgagcgcgcc
gaggatggcagcctgcccggcgggcgcatctacgcgcgcgacgccagcccggcctacgac
cccgccgaggccctgctgtgcgagctggaaggcggcgctcgagcggcgctgttcgcctcc
ggcatggccgcggcctcggcggtgctgctggcgctgaagccgggcgcgcgcatcgtcgcg
ccgcacgacatgtactggtcgctgcgcaactggatgatcggctttgccgccaactggcag
atcgcgctcgatttctacgccgacgccgcggagctcgccgcactgctgcagcgcccggcc
gacctggtgtgggtggagacgcccgcaaacccgacctgggaaatcctcgacatcgcgcgc
gccgccgaactcgcccacgccgcgggcgcgcgcctggtggtggactccaccgtgccgacc
ccggtcttcacccggccgctggcgctcggggccgacgtggtgatgcactcggcgaccaaa
tatctgaacggccactcggacgtggtcgccggcgttctggtgacgcgcgccgaggacgac
ttctgggcgcgcatcaagaccgcacgggccgccggcggcgcggtgctcggcccgttcgaa
gcctggctgctcaaccgcggcctgcgcacgctctttccccgcgtgcgcaccgctgccgcc
tcggcgctgcgcatcgcgcagcatttcgaacatcacccggcgctgctcgccgtgctctac
cccggcctgccctcgcaccgcggtcacgacatcgcctgccgccagatggaaggcggcttc
ggcgccatgctgtcgctgcgcgtgagaggcggcgaggatgccgcacgccgggtcgccggc
gcggtgaagatcttccgccgcgcgacctcgctcggctcggtcgagagcctgatcgagcac
cgcggcccgatcgagggtccgggcacgcgttgcccgctcgacctgctgcgcctctcggtg
ggcatcgaagatagcgacgacctgatcgccgacctcgaacaggcgctgcagcaagcaaac
gagccctga

DBGET integrated database retrieval system