KEGG   Thauera sp. MZ1T: Tmz1t_1586Help
Entry
Tmz1t_1586        CDS       T00804                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
tmz  Thauera sp. MZ1T
Pathway
tmz00450  Selenocompound metabolism
tmz00970  Aminoacyl-tRNA biosynthesis
tmz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tmz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Tmz1t_1586
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Tmz1t_1586
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:tmz01007]
    Tmz1t_1586
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:tmz03016]
    Tmz1t_1586
Enzymes [BR:tmz01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Tmz1t_1586
Amino acid related enzymes [BR:tmz01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Tmz1t_1586
Transfer RNA biogenesis [BR:tmz03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Tmz1t_1586
 Prokaryotic type
   Other AARSs
    Tmz1t_1586
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: ACK54344
UniProt: C4ZPE8
Position
complement(1768570..1770771)
Genome map
AA seq 733 aa AA seqDB search
MSRKLLVTNALPYANGDIHLGHLVGYIQADIWVRYQRMRGHSVHYVCADDTHGTPVMLRA
EKEGLTPEQLIERVHGEHLRDFTAFGVAFDNYHSTHSAENRFYAEDIYARLKAGGLIDTR
SIEQYYDPVKEMFLPDRFIKGECPKCGAPDQYGDNCEACGAAYAPTELKNPYSAVSGAKP
VLKTSEHYFFRLSDERAVAFLREWTRGTNAAGERRLQMEAANKMKEWLGENATEEGENTL
SDWDISRDAPYFGFEIPGAPGKYFYVWLDAPIGYLASFRNLAAKRAAAGETIAVEDYTDA
ARAAAAGTEMVHFIGKDILYFHALFWPAMLKFAGYATPSRLCVNGFLTVDGAKMSKSRGT
FITAHSYIAQKLDPEWLRYYFAGKSNGTMEDVDLNLDDMIAKVNSELVGKFVNIASRCAG
FIGKRFDGRLGEADAAACAEFAAAWSEGRVATAFEERDYSRALREVMRLADLANQYVNDH
KPWELARQEGQEARLHTVCSTALTMFRDLTRYLKPVLPALAAQVETFLAIPAMDWQGDWA
ALPAGHAIQAYSHLMTRVERKQIDALLEANRESLAPATAVPAKTDEPAKDTEAASSQQRH
AEKQQHSAQAAETASPHITIDDFTKVELRIARIVDAQHVEGADKLIRLALDIGEADESGN
PKPRQVFAGIKSAYDPATLIGRLTVMVANLAPRKMKFGMSEGMVLAASDAAGSTPGIFLL
SPDAGAHPGMKVK
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgcaagctcctcgtcaccaacgccctgccctacgccaacggcgacatccacctc
ggccacctcgtgggctacatccaggccgacatctgggtgcgctaccagcgcatgcgcggc
cactcggtgcactacgtgtgcgcggacgacacccacggcacgccggtcatgctgcgcgcc
gaaaaggaagggctcacgcccgagcagctcatcgagcgcgtgcacggcgagcacctgcgc
gacttcaccgccttcggcgtcgcattcgacaattaccactcgacgcacagcgccgagaac
cgtttctatgccgaggacatctacgccagactgaaggcgggcggcctgatcgacacacgc
tcgatcgagcagtactacgacccggtcaaggagatgttcctccccgaccgcttcatcaag
ggcgagtgcccgaagtgcggcgcccccgaccagtacggcgacaactgcgaggcctgcggc
gcggcctacgcccccaccgagctcaagaacccctattccgcggtgtccggcgccaagccg
gtgctgaagacctcggagcactacttcttccgtctgtcggacgaacgcgcggtcgccttc
ctgcgcgaatggacgcgcggaaccaacgccgccggcgagcgccgcctgcagatggaagcc
gccaacaagatgaaggagtggctcggagaaaacgcaactgaggaaggcgagaacacgctc
tccgactgggacatctcgcgcgacgcaccctacttcggcttcgagattccgggtgcgccg
ggcaagtacttctatgtgtggctggacgcaccgatcggctacctcgccagcttccgcaac
ctcgctgccaagcgcgccgccgcgggcgagacgatcgccgtcgaggactacaccgacgcc
gcccgcgccgccgcggccggcaccgagatggtgcacttcatcggcaaggacatcctctac
ttccacgccctgttctggcccgcgatgctgaagttcgccggctacgccacgcccagccgg
ctgtgcgtgaacggcttcctcaccgtcgacggcgccaagatgagcaagagccgcggcacc
ttcatcaccgcgcactcctacatcgcgcagaagctcgaccccgagtggctgcgctactac
ttcgccggcaagtcgaacggcaccatggaggacgtcgacctcaacctcgacgacatgatc
gccaaggtcaattccgagctcgtgggcaagttcgtgaacatcgccagccgctgcgccggc
ttcatcggcaagcgcttcgacggccgcctgggtgaggccgacgccgccgcctgtgccgag
ttcgccgccgcctggagcgagggccgagtcgccaccgcgttcgaggagcgcgactacagc
cgcgcgctgcgcgaggtcatgcgcttggccgacctcgccaaccagtacgtgaacgaccac
aagccctgggaactcgccaggcaggaaggccaggaagcccgcctgcacacggtgtgcagc
accgcgctgaccatgttccgcgacctcacccgctacctgaagccggtgctgccggcgctc
gccgcgcaggtcgaaaccttcctcgccatcccggccatggactggcagggcgactgggcg
gcgctgcctgccggccatgccatccaggcctacagccacctgatgacccgcgtcgagcgc
aagcagatcgacgccctgctcgaggccaaccgcgagtcgctcgccccggcgacggcggtg
cccgcgaagacagacgagcctgccaaggacaccgaggcggcgtcctcgcagcagcgccac
gccgagaaacagcagcattcggcccaggctgcggagaccgcctcgccgcatatcacgatc
gacgatttcaccaaggtcgagctgcgcatcgcgaggatcgtcgatgcccagcacgtcgaa
ggcgccgacaaactgatccggcttgcgctcgacatcggcgaggccgacgagtccggcaac
ccgaaaccgcgccaggtcttcgcgggcatcaagtcggcctacgacccggcgacgctcatc
gggcgcctgacggtgatggtcgccaacctcgcaccgcgcaagatgaagttcggcatgagc
gagggcatggtgctcgccgcctccgacgctgccggcagcacgccagggatcttcctgctc
tcgcccgacgccggcgcgcaccccggcatgaaggtgaagtaa

DBGET integrated database retrieval system