KEGG   Thauera sp. MZ1T: Tmz1t_1647
Entry
Tmz1t_1647        CDS       T00804                                 

Definition
(GenBank) putative RNA 2'-O-ribose methyltransferase
  KO
K06968  23S rRNA (cytidine2498-2'-O)-methyltransferase [EC:2.1.1.186]
Organism
tmz  Thauera sp. MZ1T
Brite
KEGG Orthology (KO) [BR:tmz00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:tmz03009]
    Tmz1t_1647
Enzymes [BR:tmz01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.186  23S rRNA (cytidine2498-2'-O)-methyltransferase
     Tmz1t_1647
Ribosome biogenesis [BR:tmz03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    Tmz1t_1647
SSDB
Motif
Pfam: RlmM_FDX FtsJ
Other DBs
NCBI-ProteinID: ACK54402
UniProt: C4ZJM0
Position
complement(1847742..1849049)
AA seq 435 aa
MCLGSDANRNCGARNPRRRGGRPDLNLRRSAGMLASAALAAYHPLPCADSGCRPCGPART
HHTAAPARTDPMNQHTPAAALACAGLLGYCRAGFEKELAAELDDIAAEAGLIGYVRAEPD
SGYVIYETFEPTPLGSFGESTDWRRPVFARQLLPWFARVDDLPERDRATPIVEAVKASGQ
RFSGVMLETPDTDEAKQRSGFCKRFTEPLAKALEKAGCLRSSRAGLPVLHVLFTSATTAW
LAAGQPGQCSTWPMGIPRVRMPSNAPSRSTAKLSEAFMMLLEEGERDSILRAGQRAVDLG
AAPGGWTWQLVNRGLRVTAIDNGPLRDSVMATEMVEHLKADGFTWRPHRPVDWMVCDMVE
QPSRIASLMAEWVATGRCRYTIFNLKLPMKRRVEAVEQCRELIRKRLASVGPYDLRIKHL
YHDREEVTAFLTLKR
NT seq 1308 nt   +upstreamnt  +downstreamnt
gtgtgccttgggagcgacgcgaatcgcaactgcggcgcgcggaacccgcgcaggcgcggc
ggccggcccgatctcaacctgcgtcgtagcgccggcatgctcgccagcgcggcgctcgcg
gcttatcatccgctgccttgcgccgattccggttgccgcccctgcggcccggcacggacc
catcatactgcagcccctgcgcgcaccgaccccatgaaccagcacacccccgccgccgcg
ctcgcctgcgccggcctcctcggctattgccgcgccggcttcgagaaggaactcgccgcc
gaactcgacgacatcgccgccgaagccggcctgatcggctacgtgcgcgccgagcccgac
tcgggctacgtgatctacgagaccttcgagcccaccccgctcggcagcttcggcgaatcc
accgactggcgccgcccggtgttcgcgcgccagctcctgccgtggttcgcgcgcgtcgac
gatctgcccgagcgcgaccgcgccacaccgatcgtcgaggcggtgaaggccagcggccag
cgcttctccggggtgatgctggagactccggacaccgacgaggccaagcagcgctcgggc
ttctgcaagcgcttcaccgagccgctcgccaaggcgctcgagaaggccggctgcctgcgc
agcagccgcgccggcctgccggtcctgcacgtgctcttcaccagcgccaccaccgcctgg
ctcgccgccggccagcccgggcagtgctcgacctggccgatgggcatcccgcgcgtgcgc
atgccctcgaacgcgcccagccgctccaccgccaagctgtccgaagccttcatgatgctg
ctcgaggaaggcgagcgcgacagcatcctgcgcgccggccagcgcgcggtcgatctcggc
gccgcgccgggcgggtggacctggcagctcgtcaatcgcggcctgcgcgtcaccgcgatc
gacaacggcccgctgcgcgacagcgtgatggcgaccgagatggtcgagcacctcaaggcc
gacggcttcacctggcgcccgcaccggccggtggactggatggtgtgcgacatggtcgag
cagccctcgcggatcgcctcgctgatggccgaatgggtcgccaccgggcgctgccgctac
acgatcttcaacctcaagctgccgatgaagcgccgcgtcgaggcggtcgagcagtgccgc
gagctgatccgcaagcggctcgccagcgtcggcccctacgacctgcgcatcaagcacctc
taccacgaccgcgaggaggtcaccgccttcctcacgctcaagcgctga

DBGET integrated database retrieval system