KEGG   Thauera sp. MZ1T: Tmz1t_1896Help
Entry
Tmz1t_1896        CDS       T00804                                 

Definition
(GenBank) cysteine desulfurase, SufS subfamily
  KO
K11717  cysteine desulfurase / selenocysteine lyase [EC:2.8.1.7 4.4.1.16]
Organism
tmz  Thauera sp. MZ1T
Pathway
tmz00450  Selenocompound metabolism
tmz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tmz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Tmz1t_1896
Enzymes [BR:tmz01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.7  cysteine desulfurase
     Tmz1t_1896
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.16  selenocysteine lyase
     Tmz1t_1896
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 DegT_DnrJ_EryC1 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: ACK54647
UniProt: C4ZMD3
Position
complement(2140092..2141375)
Genome map
AA seq 427 aa AA seqDB search
MNAPCDPGAQTPILDLAADFPILSRPLHGRRLAYLDNGATTQKPAAVIEAEARFYRESNA
NIHRGVHWLSQHATELYDGARATVQRFLNAARADEIVFTRGTTEAINLVAQSWGRPRLAA
GDEILLSTMEHHSNIVPWQLVCEQTGAVLKVIPVRDNGELDMAAFAGLLGERTRLLAITH
VSNALGTVNPVAEMTRRAHEMGAVVLVDGAQAVAHQAVDVQAIGCDFYAFSGHKLYGPTG
VGALYGRAELLRHMPPWQGGGDMIRTVAFDNTTFAPPPQRFEAGTPNIAGAIALAAAIDY
VQGVGLARIHVHEQALLDYGTRALAAIPGVRLVGTAERKAGILSFLVDGIHPHDLGTILD
AEGVAIRAGHHCAMPLMTRFGIPGTARASLGLYNGLADLDALVAAIHKAQELFGTRGGTA
SGNGRVA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgctccgtgtgaccccggcgcgcagacgcccatcctggaccttgccgccgacttc
cccatcttgtcgcggccgttgcatggccgccgcctggcctacctggacaacggcgccacc
acgcagaagcccgccgcggtgatcgaggccgaggcgcgcttctaccgcgagtccaacgcc
aacatccaccgcggcgtgcactggctgtcgcagcacgccaccgaactctacgacggcgcc
cgcgccacggtgcagcgcttcctcaacgccgcgcgcgccgacgagatcgtgttcacccgc
ggcaccaccgaggcgatcaacctggtggcgcagagctggggccggccacggctcgcggcc
ggtgacgagatcctgctcagcaccatggagcaccactcaaacatcgtgccctggcagctc
gtgtgcgagcagaccggcgcggtgctcaaggtgattccggtgcgggacaacggcgagctc
gacatggcggccttcgcgggcctgctcggcgagcgcacgcggctgctggcgatcacccat
gtgtcgaacgcgctcggcacggtcaatccggtggccgagatgacgcggcgcgcgcacgag
atgggcgcggtcgtgctcgtggacggcgcgcaggcggtggcccaccaggcggtggacgtg
caggcgatcggatgcgacttctacgccttctcgggccacaagctctacggcccaaccggc
gtcggcgcgctctacggccgcgccgagctgctgcgccacatgcccccctggcagggtggc
ggcgacatgatccgtaccgtcgccttcgacaacaccaccttcgccccgccgccgcagcgc
ttcgaggccggcacgcccaacatcgccggggcgatcgcgctggctgcggcgatcgactac
gtccaaggcgtcgggctcgcgcgcatccacgtccacgagcaggccctgctcgactacggc
acgcgcgcgctcgccgccatccccggggtacgcctggtcggcaccgcggagcgcaaagcc
ggcatcctgtccttcctggtcgacggcatccacccgcacgacctcggcaccatcctcgac
gccgagggtgtggcgatccgcgccgggcaccactgcgcgatgccactgatgacgcgcttc
ggcatccccggcaccgcgcgcgcctcgctcggcctctacaacggcctcgccgacctcgac
gcgctggtcgcggcgatccacaaggcgcaggaactgttcggcacgcgcggcggcacggcg
tctggcaacgggagagtggcatga

DBGET integrated database retrieval system