KEGG   Thauera sp. MZ1T: Tmz1t_2259Help
Entry
Tmz1t_2259        CDS       T00804                                 

Definition
(GenBank) two component transcriptional regulator, winged helix family
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
tmz  Thauera sp. MZ1T
Pathway
tmz02020  Two-component system
Brite
KEGG Orthology (KO) [BR:tmz00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Tmz1t_2259
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:tmz02022]
    Tmz1t_2259
Two-component system [BR:tmz02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   Tmz1t_2259
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C FleQ
Motif
Other DBs
NCBI-ProteinID: ACK54998
UniProt: C4ZK07
Position
2544444..2545217
Genome map
AA seq 257 aa AA seqDB search
MNQKNRYRILVVDDDARLRELLSRYLQEQGFSVKAVGDAPMMDRALHREHYDLIVLDLML
PGEDGLSICRRLRAAENQIPVIMLTAKGDDVDRIVGLEMGADDYVAKPFNPRELVARIQA
VMRRQPHTLPGAPTPEDEIVAFGRVKVNLGTRVLVRDGEEIQLTTGEFSLLKVLLTHPRQ
PLSRDKLMELARGREYGVFDRAIDVQVSRLRKLVEDDPAKPRYIQTVWGFGYVFVPDEQK
GGEDNGGQPDTPAGGED
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagaaaaaccgctatcgcattctcgtggtggatgacgacgcgcgcctgcgcgag
ttgctgtcccgataccttcaggaacaaggcttttcggtgaaggccgtcggcgatgcgccg
atgatggatcgcgccctgcaccgcgagcattacgacctgatcgtgctcgacctgatgctg
cccggcgaggacgggctgtcgatctgtcgccggctgcgcgcggccgagaaccagatcccg
gtcatcatgctcaccgccaagggtgacgacgtggatcgcatcgtcgggctggagatgggc
gccgacgactacgtcgcgaagcccttcaacccgcgtgagctggtggcgcgtatccaggcg
gtgatgcgtcgccagccccacaccctgccgggcgcgcccacccccgaggacgagatcgtc
gcgtttggccgggtcaaggtgaacctgggcacccgcgtgcttgtccgcgatggcgaggag
attcagctcaccaccggcgaattctcgctgctcaaggtgctgctaacccacccgcgccag
ccgctgtcccgcgacaagttgatggaactcgcgcgcgggcgcgagtacggtgtgttcgac
cgggcgatcgacgtccaggtctcgcgcctgcgcaagctggtcgaggacgatcccgccaag
ccgcgctacatccagaccgtgtggggtttcggctacgtcttcgtgcccgatgagcaaaag
ggcggcgaggacaacggcgggcagccggacaccccggccggcggcgaggactga

DBGET integrated database retrieval system