KEGG   Thauera sp. MZ1T: Tmz1t_2954Help
Entry
Tmz1t_2954        CDS       T00804                                 

Definition
(GenBank) 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase
  KO
K07538  6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase [EC:1.1.1.368]
Organism
tmz  Thauera sp. MZ1T
Pathway
tmz00362  Benzoate degradation
tmz01100  Metabolic pathways
tmz01120  Microbial metabolism in diverse environments
tmz01220  Degradation of aromatic compounds
Module
tmz_M00541  Benzoyl-CoA degradation, benzoyl-CoA => 3-hydroxypimeloyl-CoA
Brite
KEGG Orthology (KO) [BR:tmz00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Tmz1t_2954
Enzymes [BR:tmz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.368  6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase
     Tmz1t_2954
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C Met_10 2-Hacid_dh_C UDPG_MGDP_dh_N TrkA_N AdoHcyase_NAD Methyltransf_15
Motif
Other DBs
NCBI-ProteinID: ACR01553
UniProt: C4KAX7
Position
complement(3195538..3196605)
Genome map
AA seq 355 aa AA seqDB search
MSTKPYRWMMVEPGRPMVRTEFEIGELAADQVVVEVAGCGVCHTDLGYYYDGVRTNQPLP
LALGHEISGRVVGAGSAAGQWVGRAVVVPAVMPCGTCELCTSGHGTICRAQVMPGNDIQG
GFASHIVVPARGLCAVDEKRLAAAGLQLADVSVVADAVTTPYQAVTQAGVEPGDVAIVIG
VGGVGGYAVQIANAFGASVVAIDVDPAKLELMSKYGAALTLNAREVTGRDLKKAIEAHAK
ANGLRTTRWKIFECSGSGAGQTNAYSLINHGATLAVVGFTMDKVEVRLSNLMAFHARALG
NWGCLPEYYPAALDLVLDGRINLANFVERHPLAQINEVFEAAHAHKLSRRAILTP
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccaaaccgtatcgctggatgatggtggagccgggtcggccgatggtccgcacc
gagttcgagatcggcgagctggccgccgaccaggtggtggtcgaggtcgccggctgcggc
gtctgccacaccgatctcggctactactacgacggcgtgcgcaccaaccagccgctgccg
ctcgcgctcggccacgagatcagcggccgggtggtgggcgcgggcagcgcggcggggcag
tgggtcggccgcgcggtggtcgtgccggcggtgatgccgtgcgggacctgcgagctctgc
acgtcgggacacggcaccatctgccgcgcccaggtgatgcccgggaacgacatccagggc
ggcttcgcctcccatatcgtggtgccggcgcgcggcctgtgcgcggtcgatgagaagcgc
ctcgccgccgccggactgcaactcgccgacgtgtcggtggtggccgacgcggtcaccacg
ccctaccaggcggtcacgcaggccggagtcgagcctggcgacgtcgcgatcgtgatcggg
gtgggcggcgtcggcggctacgcggtgcagatcgccaacgccttcggtgcgagcgtggtg
gcgatcgacgtcgatccggccaagctcgaattgatgtcgaagtacggtgcggcgctgacg
ctcaatgcgcgcgaggtgaccggacgcgacctcaagaaggcgatcgaggcgcacgccaag
gccaacggcctgcgcaccacgcgctggaagatcttcgaatgctcgggcagcggtgccggc
cagaccaacgcctatagcctgatcaatcacggcgcgacgctcgcggtggtcggcttcacg
atggacaaggtcgaggttcgcctctccaacctgatggccttccatgcccgcgcgctcggc
aactggggctgcctgcccgagtactacccggccgcgctcgacctggtgctcgacggccgc
atcaacctcgccaatttcgtcgagcgccacccgctcgcgcagatcaacgaggtcttcgag
gcggctcacgcgcacaagctcagccgccgcgcgatcctgaccccctga

DBGET integrated database retrieval system