KEGG   Thauera sp. MZ1T: Tmz1t_3129Help
Entry
Tmz1t_3129        CDS       T00804                                 

Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
tmz  Thauera sp. MZ1T
Pathway
tmz00620  Pyruvate metabolism
tmz00630  Glyoxylate and dicarboxylate metabolism
tmz01100  Metabolic pathways
tmz01110  Biosynthesis of secondary metabolites
tmz01120  Microbial metabolism in diverse environments
tmz01200  Carbon metabolism
Module
tmz_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:tmz00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Tmz1t_3129
   00630 Glyoxylate and dicarboxylate metabolism
    Tmz1t_3129
Enzymes [BR:tmz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Tmz1t_3129
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase DUF826
Motif
Other DBs
NCBI-ProteinID: ACR01726
UniProt: C4KBF0
Position
complement(3384862..3387045)
Genome map
AA seq 727 aa AA seqDB search
MTERVSVQRLQVAANLKRFIEEEALPGSGVDAAAFWSGFDALVHDLAPKNAALLAERDRI
QAEIDAWHRAHPGPIADMAAYKAFLSSIGYLLPVPAGAKATTTNVDDELAVQAGPQLVVP
VMNARYALNAANARWGSLYDALYGTDAIPQKDGAELTKGYNPVRGAKVIAFGRQVLDQAA
PLAGASHADAAGYAVEAGRLVVKLQSGASTGLQQAEKFVGFQGEAAAPRAVLLKNNGLHI
EIQIDRSGAIGKSDAAGVNDLLMEAALSTIMDCEDSVAAVDADDKVVVYRNWLGLMDGTL
EDTFDKGGKPMTRRLNADREYTGADGKPVKLHGRALLFVRNVGHLMTNPAILWGEGKEIP
EGIMDAVVTTLIAKRDLERRGNSRKGSIYIVKPKMHGPAEIGFADELFTRVEQLLGLPAN
TVKLGIMDEERRTSVNLRACIAAAPARVAFINTGFLDRTGDEMHTSMEAGAMMRKGDIKN
SKWIAAYERRNVLIGLAAGLRGRAQIGKGMWAMPDLMAAMLEQKIGHPKAGANTAWVPSP
TAATLHALHYHQVSVAAVQQDIEKLDLDKEAEALLDDLLTIPVVAKAEWSETERQQELDN
NCQGILGYVVRWVEQGVGCSKVPDINDIGLMEDRATLRISSQHIANWLRHGVVPAEQVEA
TLERMAAVVDGQNAGDPLYRPMAPNFDDSVAYQAARALIFEGCAQPSGYTEPLLHRYRQQ
FKAKVGA
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaacgagtgagtgtccagcgtctgcaggtcgcagcgaacctgaagcgtttcatt
gaagaagaagccctgccgggcagcggtgtcgacgctgccgccttctggtccgggttcgat
gcgctggtacacgatctcgcaccgaagaacgccgctctgctcgccgaacgcgatcgcatc
caggccgagatcgacgcctggcatcgcgcccacccggggccgatcgccgacatggccgcg
tacaaggccttcctgtcctcgatcggctacctgctgccggtgcccgccggtgccaaggcc
accaccaccaacgtcgatgacgagctcgccgtgcaggccggcccgcagctcgtggtgccg
gtgatgaacgcgcgctacgcgctcaacgccgccaacgcgcgctggggctcgctctacgac
gcgctctacggtaccgacgccatcccgcagaaggacggcgccgagctcaccaagggctac
aacccggtgcgcggcgcgaaggtcatcgccttcggccgccaggtgctcgaccaggccgcg
ccgctcgccggtgcctcgcatgccgacgccgcgggctacgcggtcgaggccggccgcctg
gtggtgaagctgcagagcggtgccagcaccggcctgcagcaggccgagaagttcgtcggc
ttccagggcgaggccgccgcgccgcgcgccgtgctgctgaagaacaacggcttgcacatc
gagatccagatcgaccgcagcggcgccatcggcaagtccgatgccgcgggcgtgaacgac
ctgctgatggaagccgcgctgtcgaccatcatggactgcgaggactcggtcgccgcggtg
gatgccgacgacaaggtcgtggtgtaccgcaactggctcggcttgatggacggtacgctg
gaagacaccttcgacaagggcggcaagccgatgacgcggcgtctgaacgccgaccgcgag
tacaccggtgccgacggcaagccggtaaagctgcacggtcgcgcgctgctcttcgtgcgc
aacgtcggccacctgatgaccaacccggccatcctttggggcgagggcaaggaaatcccc
gaaggcatcatggatgcggtggtcaccacgctgatcgccaagcgcgacctcgagcgccgt
ggcaactcgcgcaagggcagcatctacatcgtcaagcccaagatgcacggcccggcggag
atcggcttcgccgacgagctgttcacccgcgtcgagcagctgctcgggctgccggccaac
accgtcaagctcggcatcatggacgaggagcgccgcaccagcgtcaacctgcgtgcctgc
atcgccgccgcgccggcgcgcgtggccttcatcaataccggcttcctcgatcgcaccggc
gacgagatgcacacctcgatggaggccggcgcgatgatgcgcaagggcgacatcaagaac
agcaagtggatcgccgcctacgagcgccgcaacgtgctcatcggtctggccgccggcctg
cgcggccgcgcccagatcggcaagggcatgtgggccatgcccgacctgatggccgcgatg
ctcgagcagaagatcggccatcccaaggcgggcgccaacaccgcctgggtgccgtcgccg
accgccgccaccctgcatgcgctgcattaccaccaggtcagcgtggccgcggtgcagcag
gacatcgagaagctcgacctcgacaaggaagccgaggcgctgctcgacgacctgctcacc
atcccggtggtggccaaggccgagtggagcgagaccgagcgccagcaggaactcgacaac
aactgccagggcatcctcggctacgtggtgcgctgggtggagcagggcgtgggctgctcg
aaggtgcccgacatcaacgacatcggcctgatggaagaccgcgccacgctgcgcatctcc
agccagcacatcgccaactggctgcgccatggcgtggtgcccgccgagcaggtcgaggcc
acgctcgagcgcatggccgcggtggtcgatggccagaacgcgggcgacccgctgtaccgc
ccgatggcgccgaacttcgacgactcggtggcctaccaggccgcgcgcgcgctgatcttc
gagggctgcgcccagccgagcggctacaccgagccgctgctgcaccgctatcgccagcag
ttcaaggccaaggtcggcgcctga

DBGET integrated database retrieval system