KEGG   Thauera sp. MZ1T: Tmz1t_3459Help
Entry
Tmz1t_3459        CDS       T00804                                 

Definition
(GenBank) Protein-L-isoaspartate(D-aspartate) O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
tmz  Thauera sp. MZ1T
Brite
Enzymes [BR:tmz01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Tmz1t_3459
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT RrnaAD Methyltransf_25 MTS Met_10 PrmA Methyltransf_31 Methyltransf_11 Methyltransf_4 tRNA_U5-meth_tr Methyltransf_23 Methyltransf_18 Methyltransf_12 Ubie_methyltran DUF938 NodS Methyltr_RsmB-F
Motif
Other DBs
NCBI-ProteinID: ACR02053
UniProt: C4KCV5
Position
complement(3781692..3782345)
Genome map
AA seq 217 aa AA seqDB search
MNFEKARFNMVEQQIRPWEVLDQDVLDLLMTVKREEFVPAAHRELAFADVEIPIGCGQVM
LKPVIEGKILQALRVTKSDTVLEIGAGSGWFAALLAARAEWVRTMEIEPELVKLASANLE
RNGVHNVVVVDGDGVQGWSGRAPYDVIVVSGGLPFVPQSLLEQLKVGGRLFAFVGEAPVM
KARLITCEGEGRFRTEDVFETVVPMLKNAPQREAFSF
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgaacttcgagaaagcgcgcttcaacatggtcgagcagcagatccgcccctgggaggtg
ctggatcaggacgtgctcgacctcctgatgacggtcaagcgcgaggaattcgttcccgcc
gcgcatcgcgagctggccttcgccgacgtcgagatcccgatcggctgtggccaggtcatg
ctcaagccggtgatcgaaggcaagatcctgcaggcgctgcgtgtcaccaagtccgacacc
gtgctcgagatcggcgccggctcgggctggttcgccgcgctgctggcggcgcgtgccgag
tgggtgcgcaccatggagatcgagcccgagctggtgaagctggcgagcgccaacctcgag
cgcaacggcgtgcacaacgtggtcgtggtcgacggcgacggtgtgcagggatggtctggc
cgcgcgccctacgacgtgatcgtcgtttccggcgggctgcccttcgtgccgcagtcgctg
ctcgagcagctcaaggtgggtggtcgcctgttcgccttcgtcggcgaggcgccggtcatg
aaggcgcgcctgatcacctgtgagggcgaaggccgcttccgtaccgaggacgtgttcgag
accgtggtgcccatgctcaagaacgcgccccagcgcgaagccttcagcttctga

DBGET integrated database retrieval system