KEGG   Thauera sp. MZ1T: Tmz1t_3844Help
Entry
Tmz1t_3844        CDS       T00804                                 

Definition
(GenBank) 5,10-methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
tmz  Thauera sp. MZ1T
Pathway
tmz00670  One carbon pool by folate
tmz01100  Metabolic pathways
tmz01120  Microbial metabolism in diverse environments
tmz01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tmz00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Tmz1t_3844
Enzymes [BR:tmz01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     Tmz1t_3844
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: ACR02433
UniProt: C4KD22
Position
4238257..4239090
Genome map
AA seq 277 aa AA seqDB search
MKPEISIEFFPPTTAEGAEKLHATREKLAALEPAFFSVTYGAGGSTRERTFATVKEIAAA
GHEAAPHLSCVGSSRDSIREILQEYAAAGIRRIVALRGDLPSGAGAAGEFRYASELVEFI
RSETGDRFRIEVAAYPEWHPQAKSPKDDLAAFKRKVEAGADSAITQYFYNLDAYLNFVDA
VRRMGVDVPIVPGIMPIGSFSKLARFSDACGAEIPRWMRKTFESYGDDSDAIRAFGLDVV
TRLCEKLLAAGAPGLHFYSMNMAGPTTEICRRLGLTA
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgaaacccgaaatctccatcgagttcttcccgcccaccacggccgagggcgccgagaag
ctgcatgccacccgggagaagctcgccgcgctcgagccggccttcttctcggtgacctac
ggcgccggcggctccacccgcgagcgcaccttcgccaccgtgaaggagatcgccgccgcc
ggccacgaggccgcgccacacctgtcctgcgtgggctcgtcgcgcgacagcatccgcgag
atcctgcaggaatacgccgccgccggcatccgccgcatcgtcgcgctgcgcggcgatctg
ccctcgggcgccggcgcggcgggcgagttccgctacgccagcgagctcgtcgagttcatc
cgcagcgagacgggcgaccgcttccgcatcgaggtcgcagcctaccccgagtggcacccg
caggcgaagagcccgaaggacgacctcgccgccttcaagcgcaaggtcgaggccggcgcc
gactcggcgatcacgcagtatttctacaacctcgacgcctacctgaacttcgtcgacgcg
gtgcgcaggatgggcgtcgacgtgccgatcgtgcccggcatcatgccgatcggcagcttc
agcaagctggcgcgcttctcggatgcctgcggcgccgagatcccgcgctggatgcgcaag
accttcgagagctacggcgacgacagcgacgcgatccgcgccttcggcctcgacgtggtc
acccggctgtgcgagaagctgctcgccgcgggcgcgcccggcctgcatttctacagcatg
aacatggccggcccgaccaccgagatctgccggcggctggggctgactgcctga

DBGET integrated database retrieval system