KEGG   Thermotoga neapolitana: CTN_0474Help
Entry
CTN_0474          CDS       T00847                                 

Definition
(GenBank) Aminomethyltransferase
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
tna  Thermotoga neapolitana
Pathway
tna00260  Glycine, serine and threonine metabolism
tna00630  Glyoxylate and dicarboxylate metabolism
tna00670  One carbon pool by folate
tna01100  Metabolic pathways
tna01110  Biosynthesis of secondary metabolites
tna01130  Biosynthesis of antibiotics
tna01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CTN_0474
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CTN_0474
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    CTN_0474
Enzymes [BR:tna01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     CTN_0474
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C SoxG DUF3659 TrmE_N Imm52
Motif
Other DBs
NCBI-ProteinID: ACM22650
UniProt: B9K6R7
Position
complement(468664..469755)
Genome map
AA seq 363 aa AA seqDB search
MKRTPLYERHVALGAKMVDFAGWIMPLYYSSIFEEVMAVRKSVGVFDVSHMGEIVVEGQE
TVDFVNFLVTNDFSAIPEGKAMYTVMCNETGGIVDDLVVYRISHEKAIMVVNAANIEKDY
EWIKVHAKNFNVEVRNVSDETALVAFQGPKSQETLQRVVDIDLEGIGYYSFQWGRLDGER
VLVSRTGYTGEDGFELMMNAESAAKIWDTLVEIAGNVDGKPAGLGARDVCRLEASYLLYG
QDMDESTNPFEVGLSWVVKMNKDFVGKEALLKLKEKVERKLVALELSGRRIARKGYTVLK
EGKEVGKITSGNFSPTLGKSIALALVSRCVKTGDRLEVVFPGKNVEAHVVKKPFYRGSVR
REA
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgaagaggacccctctctatgaaaggcacgttgctctgggggcaaaaatggtcgatttt
gcaggctggatcatgcctctttattactcgtccatattcgaggaagtgatggccgtcaga
aagtcagtaggggtgttcgacgtttcacacatgggtgagatcgtcgtggaaggtcaggaa
actgtggactttgtgaattttcttgtcacgaacgatttctccgccatccctgaaggaaag
gcgatgtacactgtgatgtgtaacgaaacgggggggatcgttgacgatcttgtggtttat
aggatatctcacgagaaagcgatcatggttgtgaatgcggcgaacatcgagaaagattac
gaatggataaaagtgcatgcgaaaaatttcaacgtcgaagtgaggaatgtctccgatgaa
acggcgcttgtggccttccaaggaccgaagtctcaggagacccttcaaagagttgtggat
atcgatcttgaagggattggttactattcgttccaatggggaaggttggatggagagaga
gttcttgtatcccgaacaggctacacaggagaagatggtttcgagttgatgatgaacgca
gaaagcgctgcgaagatttgggatactctcgtagagatcgctggtaacgtggatggaaaa
cccgccggtctgggagcccgtgatgtgtgtcgtcttgaagcatcttaccttctctacggt
caggatatggatgagagcaccaatccgttcgaagtgggactctcatgggtagtgaagatg
aacaaagacttcgtcgggaaagaggcactgctcaaactgaaagaaaaagtcgaaaggaaa
ctcgtagcactggaactttcgggaagaagaatcgcaagaaagggttacaccgttttgaaa
gaaggaaaagaggtgggaaagataacaagtgggaacttttcacctaccctcggaaaatcg
atagccctggctctcgtatccaggtgcgtgaagaccggcgatcggctggaagttgtgttt
cctggaaagaacgtggaagcccatgttgtgaaaaaaccgttctacagaggaagtgtgagg
agggaggcgtga

DBGET integrated database retrieval system