KEGG   Thermotoga neapolitana: CTN_1037
Entry
CTN_1037          CDS       T00847                                 
Name
(GenBank) 50S ribosomal protein L27
  KO
K02899  large subunit ribosomal protein L27
Organism
tna  Thermotoga neapolitana
Pathway
tna03010  Ribosome
Brite
KEGG Orthology (KO) [BR:tna00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    CTN_1037
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:tna03011]
    CTN_1037
Ribosome [BR:tna03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    CTN_1037
  Bacteria
    CTN_1037
SSDB
Motif
Pfam: Ribosomal_L27 Biotin_lipoyl_2
Other DBs
NCBI-ProteinID: ACM23213
UniProt: B9K8D0
Position
1008670..1008921
AA seq 83 aa
MAHKKSGGVAKNGRDSLPKYLGVKVGDGQFVKAGNILVRQRGTRFHPGKNVGMGRDFTLF
ALKDGRVKFEQKNNKKYVSVYEE
NT seq 252 nt   +upstreamnt  +downstreamnt
atggcgcataaaaagagtggcggtgttgcaaagaacggcagagacagtcttccaaagtat
cttggggttaaagtgggagacgggcaattcgtaaaagcagggaacatacttgtgaggcag
aggggtacaaggtttcacccaggaaagaacgtcggaatgggaagagatttcacgctcttt
gctctgaaggatggtagggtgaagttcgaacagaaaaacaacaaaaagtatgtgagcgtc
tatgaggagtga

DBGET integrated database retrieval system