KEGG   Thermotoga neapolitana: CTN_1247
Entry
CTN_1247          CDS       T00847                                 
Name
(GenBank) 30S ribosomal protein S15
  KO
K02956  small subunit ribosomal protein S15
Organism
tna  Thermotoga neapolitana
Pathway
tna03010  Ribosome
Brite
KEGG Orthology (KO) [BR:tna00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    CTN_1247
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:tna03011]
    CTN_1247
Ribosome [BR:tna03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    CTN_1247
  Bacteria
    CTN_1247
  Archaea
    CTN_1247
SSDB
Motif
Pfam: Ribosomal_S15 LMP 3-PAP
Other DBs
NCBI-ProteinID: ACM23423
UniProt: B9K8Z0
Position
complement(1209009..1209278)
AA seq 89 aa
MALDPEKKKEIINEFQIHENDTGSVEVQIALLTARIKHLTEHLKKHPKDFHSRRGLMKMI
GRRRKLLKYLRRKKPEVYRELIAKLGIRK
NT seq 270 nt   +upstreamnt  +downstreamnt
gtggcgcttgacccagaaaagaagaaagagatcatcaacgagtttcagattcacgaaaac
gacaccggttctgttgaggtacagatcgcccttctcacagcgaggatcaaacacttaaca
gaacacctgaaaaagcaccccaaggactttcactccagaagaggcctgatgaagatgatc
ggaagaagaaggaaactcttgaagtatttgagacgcaaaaaaccagaagtctaccgagaa
ctcattgccaagttaggtatcaggaaataa

DBGET integrated database retrieval system