KEGG   Thermotoga neapolitana: CTN_1698Help
Entry
CTN_1698          CDS       T00847                                 

Definition
(GenBank) Enolase
  KO
K01689  enolase [EC:4.2.1.11]
Organism
tna  Thermotoga neapolitana
Pathway
tna00010  Glycolysis / Gluconeogenesis
tna00680  Methane metabolism
tna01100  Metabolic pathways
tna01110  Biosynthesis of secondary metabolites
tna01120  Microbial metabolism in diverse environments
tna01130  Biosynthesis of antibiotics
tna01200  Carbon metabolism
tna01230  Biosynthesis of amino acids
tna03018  RNA degradation
Module
tna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
tna_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:tna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CTN_1698
  09102 Energy metabolism
   00680 Methane metabolism
    CTN_1698
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    CTN_1698
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:tna03019]
    CTN_1698
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tna04147]
    CTN_1698
Enzymes [BR:tna01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.11  phosphopyruvate hydratase
     CTN_1698
Messenger RNA biogenesis [BR:tna03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     CTN_1698
Exosome [BR:tna04147]
 Exosomal proteins
  Proteins found in most exosomes
   CTN_1698
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Enolase_C Enolase_N MR_MLE_C MAAL_C
Motif
Other DBs
NCBI-ProteinID: ACM23874
UniProt: B9KA91
Position
1662457..1663755
Genome map
AA seq 432 aa AA seqDB search
MEIVYVEIVDVRAREVLDSRGNPTVEAEVVLEDGTVGRAIVPSGASTGKFEALEIRDKDK
KRYHGKGVLKAVENVNETIAPALIGMNAFDQPLVDKTLIELDGTENKSKLGANAILAVSM
AVARAAANYLGLPMYKYLGGVNAKVLPVPLMNVINGGQHADNNLDLQEFMIVPAGFDSFK
EALRAGAEIFHTLKKILHDSGHVTAVGDEGGFAPNLSSNEEAIKILIEAIEEAGYKPSEQ
VFIALDCAASSFYDEEKGVYFVDGEEKSSEVLMGYYEELIAKYPIISIEDPFAEEDWDAF
VEFTKRVGNKVQIVGDDLYVTNVKRLSKGIELKATNSILIKLNQIGTVTETLDAVELAQK
NNMTAIISHRSGESEDTFIADLAVATNAGFIKTGSLSRSERIAKYNQLLRIEEELGKVAE
FRGLSSFYSIKR
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
gtggagattgtgtacgtggaaatcgttgatgtgagggcaagagaagttctcgattctcga
ggaaatcccaccgttgaagccgaagtcgttctggaagatggtactgtgggaagggcgatc
gttccctctggagcatccaccggaaagttcgaagctctggagataagggacaaagacaag
aaaaggtaccacggaaaaggcgtactgaaagccgtagaaaacgtcaacgagacaatcgca
cctgctctgatcggcatgaacgccttcgatcagccccttgtggacaaaaccctgatcgaa
ctcgacggcacagaaaacaaatcgaaactcggtgccaacgctattctcgctgtttccatg
gcagtggcaagagcggcagcgaattaccttggacttccgatgtacaaatatctcggtgga
gtcaacgcgaaggtacttcccgttcctcttatgaacgtaataaacggtggtcagcacgca
gataacaacctcgacctccaggaattcatgatcgttccggcaggatttgacagtttcaag
gaagccctgagagcaggagcagagatcttccacaccctcaagaagattcttcacgattct
gggcatgtgacggcggtcggtgacgaaggtggattcgcaccgaacctctcatccaacgaa
gaggcgataaagatactgattgaagccatagaggaagctggttacaaacccagcgaacag
gtgttcatcgccctcgactgtgccgcatcctctttctacgacgaagaaaaaggagtctac
ttcgttgatggcgaggaaaagtccagcgaggtgctcatgggatactacgaggaactgata
gcaaagtatccaatcatatccatcgaagatccgttcgcggaagaagattgggatgcgttc
gttgaattcaccaagagggtaggaaacaaggttcagatcgtgggagacgacctctacgtg
accaacgttaagagactctccaagggaatcgaactcaaagcgacgaactccattctcata
aagctcaaccagataggaaccgtcacggaaacactcgatgccgtagaactcgctcagaag
aacaacatgacggccatcatctcccacagatccggagagagcgaagataccttcatagca
gatcttgctgtggccaccaacgccggattcatcaagacgggatccctgtccaggagtgaa
agaatcgccaagtacaatcagcttctgagaattgaggaagaacttggaaaagtggcagag
ttcagagggctttcttccttctattccataaagagatga

DBGET integrated database retrieval system