KEGG   Pyrobaculum neutrophilum: Tneu_0421Help
Entry
Tneu_0421         CDS       T00682                                 

Definition
(GenBank) Aldehyde Dehydrogenase
  KO
K15038  succinyl-CoA reductase [EC:1.2.1.76]
Organism
tne  Pyrobaculum neutrophilum
Pathway
tne00720  Carbon fixation pathways in prokaryotes
tne01100  Metabolic pathways
tne01120  Microbial metabolism in diverse environments
tne01200  Carbon metabolism
Module
tne_M00374  Dicarboxylate-hydroxybutyrate cycle
Brite
KEGG Orthology (KO) [BR:tne00001]
 09100 Metabolism
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Tneu_0421
Enzymes [BR:tne01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.76  succinate-semialdehyde dehydrogenase (acylating)
     Tneu_0421
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ACB39369
UniProt: B1YBY5
Position
complement(379540..380949)
Genome map
AA seq 469 aa AA seqDB search
MTNLVVVNPATEEAIAELPQATREDVRRAIDAAWDAFASWSALPLRKRTRVLLKTAELAE
AAREDLLKTLVAESGKPIRDAEAEITRAIDIFRSSAEEAKLILEGSAPRVDAYEYPIGNE
NRLVVAVREPVGVVGGALSYNNPASTFAHKVAPVIAAGNTVVVKPSSYTPLTALKFLEIM
KRAGVPEGVVNVVVGSGEEVFDELIQSDKVAGINFTGSTAVGLQVAAKAASRGKKFMIAP
GGSDPAVVFKDADLDAAARIVARARYENAGQNCNATKRVFVEREVYPRFVELLLGYVKAI
RVGDPMDYSTDMGPLISEKIVKAMDGVVKDALEKGAKLAAGGRRMNRRGYFYEPTVLLFD
GDAEAKALREEVFGPVLPVVPFEGEEEAVRLANATQYGLQSAVFTSDYRKALRVARGIKA
GAVMINESTRVRFDALPYGGVKMSGFGWREGVRSTMIYYTEPKFLVFGL
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgacaaacctagtggtggttaatccagccaccgaggaggcaatcgccgagctcccacaa
gccacgagagaagacgtgaggagggccatagacgccgcgtgggacgccttcgccagctgg
tcggctctccccctgaggaagaggacccgcgtcttgctgaagaccgccgagcttgccgag
gccgccagggaggacctcctcaagacgctggtggcggagtcaggaaagcccatcagagat
gcggaggcggagatcacgagggcgatagacatcttccgctccagcgcggaggaggccaaa
ctgatcctggaggggtccgcccccagggtagacgcctacgagtacccaatcggcaacgaa
aacaggctcgtggtggccgtgagggagcccgtgggcgtcgtcgggggggccctcagctac
aacaaccccgcctccaccttcgcccacaaggtggcccccgtcatcgcggcggggaacaca
gtcgtcgtgaagccctcctcctacacccccctcaccgccctcaagttcctggagattatg
aagagggctggggtgcccgagggggtggtaaacgtggttgtgggcagcggggaggaggtc
ttcgacgagcttatccagagcgacaaggtcgctgggataaacttcaccggtagcacagcg
gtagggctacaggtggcggctaaggccgcctccagggggaagaagttcatgatagcgcca
gggggctccgacccggccgtggtgtttaaagacgccgatttagacgcggcggctaggatc
gtcgccagagcccggtacgaaaacgcgggccagaactgcaacgccaccaagagggttttc
gtggagcgggaggtctaccccaggttcgtggagctcctcctcggctatgtgaaagccata
agggtgggcgaccccatggactacagcacggacatggggcccctcatctccgagaagata
gtgaaggccatggacggcgtagtgaaagacgcccttgagaaaggcgctaagctggcggcg
gggggcaggagaatgaacaggaggggctacttctacgagcccaccgtcctcctcttcgac
ggcgacgccgaggctaaggcgcttagggaggaggtcttcgggccggttctgcccgtggtg
cccttcgagggggaggaggaggccgtccgcctcgccaacgccacccagtacggcctacag
tcggccgtcttcacctcggactacaggaaggcgcttagggtggcgagaggcataaaggcg
ggggcggtcatgataaacgagagcaccagggtgaggttcgatgcccttccctacggcggc
gttaagatgtcgggcttcggctggagagagggcgtgaggtcgaccatgatatactacaca
gagcccaagttcctcgtcttcgggctttga

DBGET integrated database retrieval system