KEGG   Pyrobaculum neutrophilum: Tneu_0616Help
Entry
Tneu_0616         CDS       T00682                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tne  Pyrobaculum neutrophilum
Pathway
tne00010  Glycolysis / Gluconeogenesis
tne00051  Fructose and mannose metabolism
tne00562  Inositol phosphate metabolism
tne01100  Metabolic pathways
tne01110  Biosynthesis of secondary metabolites
tne01120  Microbial metabolism in diverse environments
tne01130  Biosynthesis of antibiotics
tne01200  Carbon metabolism
tne01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tne00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tneu_0616
   00051 Fructose and mannose metabolism
    Tneu_0616
   00562 Inositol phosphate metabolism
    Tneu_0616
Enzymes [BR:tne01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Tneu_0616
Exosome [BR:tne04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Tneu_0616
  Exosomal proteins of bladder cancer cells
   Tneu_0616
  Exosomal proteins of melanoma cells
   Tneu_0616
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM ThiG His_biosynth FMN_dh IGPS NMO PA HEV_ORF1
Motif
Other DBs
NCBI-ProteinID: ACB39555
UniProt: B1YCP2
Position
557846..558520
Genome map
AA seq 224 aa AA seqDB search
MRLPILIINFKAYAEAAGRRALEIAKAAERAARELGVNIAVAPNHLELALVAQSVDIPVY
AQGADVETPGAHTAHVAVDNVKEAGAAGLILNHSEAPLALSQLSRLAARAKAVGLDLVIC
APDPDTSLAAAALKPHAVAVEPPELIGTGRAVSRYKPEAVVQTVEKVSRHFPDVAVITGA
GIESGEDVAAALKLGTRGVLLASAAVKAKDHYQKILELAKPLAD
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgaggctccccatcttgatcataaacttcaaggcctacgccgaggccgccggcaggcgg
gctctggagatagcaaaggccgcggagagagccgccagagagctgggggtaaacatagcg
gttgcccccaaccacctggagctagcgctggtggcccagtccgtcgacatcccggtatat
gcccaaggcgccgatgtcgagacgccgggggcgcacacggcgcatgtggccgtggacaac
gttaaagaggctggggcggcgggcctcatcttgaaccacagcgaggcccccctcgccctc
agccagctgtctaggctagcggctagggcaaaagccgtgggtctagacctggtgatatgt
gccccggaccccgacacgtccctcgccgcggccgccctaaagccgcacgccgtcgccgta
gagccccccgagctcataggcacggggagggcggtctctaggtacaagcccgaggccgtg
gtgcagaccgtggaaaaggtgtcgaggcacttcccagatgtggctgttataacgggcgcc
ggcatagagtccggcgaggacgttgccgcggccctcaagctaggcaccagaggcgtactg
ctcgccagcgccgccgtcaaggccaaggaccactaccagaagatcctcgagctggcgaag
cctctggccgattaa

DBGET integrated database retrieval system