KEGG   Pyrobaculum neutrophilum: Tneu_1028Help
Entry
Tneu_1028         CDS       T00682                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tne  Pyrobaculum neutrophilum
Pathway
tne00260  Glycine, serine and threonine metabolism
tne00400  Phenylalanine, tyrosine and tryptophan biosynthesis
tne01100  Metabolic pathways
tne01110  Biosynthesis of secondary metabolites
tne01130  Biosynthesis of antibiotics
tne01230  Biosynthesis of amino acids
Module
tne_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tne00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tneu_1028
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Tneu_1028
Enzymes [BR:tne01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Tneu_1028
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACB39959
UniProt: B1YDU6
Position
complement(919563..920924)
Genome map
AA seq 453 aa AA seqDB search
MGVRAPQEEWMVPRRWYNIVPDLPKPLPPYLKPNGEPVRPEEFEVLFARELVRQEFSQER
WIPVPPPVRDVYLLWRPTPLLRARRLEELLKTPARIYYKFEGVSPPGSHKPNTAVAQLYY
VSKEGAGRVTTETGAGQWGSSVAFAASLFGVKATVYMVRASYGQKPYRRVLMELWGAEVV
PSPSDRTEAGRRFLAEDPNHPGSLGIAISEAVEDAVKTGAKYVLGSVLNHVLIHQTVIGL
EAAEQIRYFGDYPDYVVGACGGGSSFSGLFWPFYHEKRVGKAERDVKFVAVEPVAVPTLT
RGEYIYDLGDTAGLTPLIKMYSVGHGYKPPPIHAGGLRYHGCAPTLSLLVAEGEVSAVAY
RQREVFEAARLFAQAEGVVPAPESAHAVKAAVELALQAKREGRPVTILFNMSGHGLLDLA
AYDEYMRGVLQDVEPTAEEIMANIARAKALLRQ
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgggcgtgagggctccgcaggaggagtggatggtcccccgccggtggtacaacatcgtc
cccgatctgcccaagcccctgccgccgtatcttaagcctaacggcgagccggtgaggccg
gaggagttcgaggtgttgtttgcgagggagctggttaggcaggagttctcccaggagagg
tggatcccggtgccgccccccgtgagagacgtgtacctcctctggcggccgacgccgctt
ctgagggcgaggaggctggaggagctcctcaagacgccggcgaggatctactacaagttc
gagggggtttcgccgccggggagccacaagccgaacacggcggtggcccagctgtactac
gtatcgaaggagggggcggggagggtcaccaccgagactggggcggggcagtggggctcc
tcggtggccttcgccgcctctctattcggcgtgaaggccaccgtctacatggtcagggcg
tcctacggccagaagccctacaggagggtcctcatggagctgtggggggcggaggtggtg
cccagccccagcgacaggaccgaggccgggaggaggttcctggccgaggaccccaaccac
ccggggtcgctggggatagccatctcggaggctgtggaagacgccgtgaagacgggggcg
aagtacgtcctcggctcggtcctcaaccacgtacttatccaccagacggttataggcctc
gaggcggctgagcagatcaggtacttcggcgactacccagactacgtggtgggggcctgc
ggaggcggcagctccttctcgggcctcttctggcctttctaccacgagaagagggtgggg
aaggccgagagggatgtgaagttcgtggcggtggagcccgtggcggtccccaccttgacc
aggggggagtacatatacgacctgggggacacggccggcttgacgcccttgatcaagatg
tactccgtgggccacggctacaagccgcctcccatacacgcgggtggtctgaggtaccac
ggctgcgcgcccaccctctccctgctcgtggcggagggggaggtctccgcggtggcctac
aggcagagggaggttttcgaggcggcgaggctgttcgcccaggcggagggggtggtgcct
gcgcccgagtcggcccacgccgtgaaagccgccgtggagctggctctgcaggccaagagg
gaggggaggcccgtcacgatcctcttcaacatgtcgggccacggcctcctggatctggcg
gcttacgacgagtacatgaggggggttctgcaggacgtggagccgactgcggaggagatt
atggcgaacatcgccagagctaaggcccttctccgtcagtag

DBGET integrated database retrieval system