KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00002088G001Help
Entry
GSTEN00002088G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:tng00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    GSTEN00002088G001
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tng01001]
    GSTEN00002088G001
Enzymes [BR:tng01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     GSTEN00002088G001
Protein kinases [BR:tng01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   GSTEN00002088G001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo Pkinase_fungal APH Pox_ser-thr_kin YrbL-PhoP_reg FTA2 RIO1
Motif
Other DBs
NCBI-ProteinID: CAF88597
UniProt: Q4TET5
Position
undetermined
AA seq 357 aa AA seqDB search
GAFSEVYMVKEKKSGKLFAMKCVKKKQKRDLNLENEIAVLRRFDFSLLPLVCSGEIEGRI
PQTSSVVSGFYRQGQARERCGDGGVLREPDPLLSHHAAVSFSPPHPRLTSIIQKWNQTPG
SALRVSGGELFDRILDRGVYSEKDASCVIQQVLQAVSYLHQSGIVHRDLKPENILYFNQD
ENSKIMISDFGLSKMVDKDIMSTACGTPGYVGKKGPRLHPGRPPVSSALTELSSSPPAPE
VLAQKPYSKAVDCWSIGVITYILLCGYPPFYEESESRLFSKIMKAQYEFDSPFWDNISES
AKDFIRNMMQKNASMRYTPEQALRHPWIVGKTARSQDIYYSVSVQIQKNFARTKWKV
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
ggcgcgttctcggaggtgtacatggtgaaggagaagaagtcggggaagttgtttgccatg
aagtgtgtgaagaagaaacagaagcgagatctgaacctggagaacgagatcgctgtgctg
agaaggttcgatttttccctccttccactggtgtgttccggtgagattgaaggtagaatc
ccacaaacgtcttctgttgtctccggtttttaccgacagggtcaagcacgagaacgttgt
ggggatggaggagttctacgagagccggacccactactatctcatcatgcagctgtgagt
ttttcacctcctcatccccgtctcacttcgatcatccagaagtggaatcaaactccgggt
tctgctctcagagtttccggcggggagctctttgaccggattctggaccgcggcgtgtac
tctgagaaggacgccagctgtgtgatccagcaggttctgcaggccgttagctatctgcac
caaagcggcatcgtgcatcgggacctcaagcctgagaacatcctgtacttcaaccaggat
gagaactccaaaatcatgatcagcgatttcggcttgtccaagatggtggacaaagacatc
atgtccacggcgtgcggaacgccaggatacgtgggtaagaaagggccccgtcttcaccct
ggacgtccgcctgtgtcctcggctctgacggaactgtcctcttcacctccagctcctgag
gttctggcccagaaaccctacagcaaagctgtggactgctggtccatcggggtcatcacc
tacatcctcctctgcggatacccgcctttctatgaggaaagcgagtccaggctcttctcc
aaaatcatgaaggcgcagtacgagttcgactcgcccttctgggacaacatttctgaatcc
gccaaagatttcatccgcaacatgatgcagaagaatgccagcatgcgctacaccccggaa
caggcgctccgacacccctggatcgtcggaaagacggcgcgcagccaggacatctattac
tccgtcagcgttcagatccagaagaactttgccaggactaagtggaaggtc

DBGET integrated database retrieval system