KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00002349G001
Entry
GSTEN00002349G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng00230  Purine metabolism
tng00240  Pyrimidine metabolism
tng01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tng00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    GSTEN00002349G001
   00240 Pyrimidine metabolism
    GSTEN00002349G001
Enzymes [BR:tng01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     GSTEN00002349G001
SSDB
Motif
Pfam: dNK
Other DBs
NCBI-ProteinID: CAF88779
UniProt: Q4TEA3
Position
undetermined
AA seq 299 aa
AAGKSTLVRLLEGASEDWEVIPEPIGKWCNIDKVGDDMYQVNIHNSGPWSSSSSILLFFL
FAGVELLSEERRKHPADAVPPAEPLGLHLSGKDPVLWGDFQRLTCLSSSVWQSYTCISRV
RSQLQRPSGKLKEAGNPVQFYERSVYSDRFVFASNLFEGGDMTETEWSVYRDWHTWMLKQ
CEPAIALDAIIYLRAPPQAACSACSTGAGRRSRAFLWSIWNSFTLNTSPGCTTGTRGEQA
AEHTAARSCANQERWRDGDECAAFRLDFDYLNDLPVLVLDVDDDFKSDGIKREAIIDKV
NT seq 897 nt   +upstreamnt  +downstreamnt
gctgcgggaaagtcgactttggtgcgccttcttgagggagcatcagaggactgggaggtg
attcctgaacctatagggaaatggtgcaacatcgacaaagtcggtgatgacatgtaccag
gtaaacatacacaacagtggaccgtggagcagctcttcttctattctactgttctttctc
tttgcaggagttgagctcctctcagaagagcggaggaaacatcctgcagatgctgtacca
ccagccgagccgctgggcctacacctttcaggtaaggatcccgtcctctggggtgatttc
caaaggctgacctgcctgtcctcctcggtctggcagagctacacctgtatcagcagggtt
cgttcacagcttcagcgtccgtcgggtaagctcaaggaggccggaaatcccgttcagttc
tacgagcgctccgtttactcggacaggttcgtgtttgcgtccaacctctttgagggcggc
gacatgacagaaacggagtggagcgtttaccgggactggcacacctggatgctgaagcag
tgtgagcccgccatcgccctggacgccatcatctacctgcgagcaccgccacaggctgca
tgcagcgcctgctccaccggggcagggaggaggagcagggccttcctctggagtatctgg
aacagcttcaccttaaacacgagtcctggctgtaccacaggaacacgaggtgagcaggcc
gccgagcacaccgccgcacgctcgtgcgcaaatcaagagcgatggcgtgacggagatgag
tgtgctgctttcaggctggacttcgactacctcaacgaccttcccgttctcgtcctcgac
gttgacgacgacttcaagagcgacgggatcaaacgggaagccatcatcgacaaggtt

DBGET integrated database retrieval system