KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00004043G001
Entry
GSTEN00004043G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K02296  aryl hydrocarbon receptor nuclear translocator-like protein 1
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Brite
KEGG Orthology (KO) [BR:tng00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tng03000]
    GSTEN00004043G001
Transcription factors [BR:tng03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    GSTEN00004043G001
SSDB
Motif
Pfam: PAS_11 PAS_3 PAS HLH PAS_9 PAS_4 PAS_2
Other DBs
NCBI-ProteinID: CAF89986
UniProt: Q4TAU6
Position
undetermined
AA seq 441 aa
REPHSQIEKRRRDKMNHLIEELSAMIPACQHMAQKLDKLTVLRKAVQHLKALKGTESGGA
FTHTTHKPSILPNDELRQLLLRAADGFLLVVSCDRAKILFISESVSEILNFSPLELTGQS
LFDFIHPKDITKVKEQLASSELHNHRLIDAASESGPRASRSRQTAANLTCLCAAGVPVQA
EAPVRASVLTTGARRAFFCRMKHSQAMGKRDDKQVLPSTSKKKGRCCALYNHEVRPVNTG
AWLAEARQWRHLAVSLGKRPTAWRNGREQGKVYRDSSRYRTLRCTGYMRSWLSGQPEPEA
DAPDKDTPALTCLVMVCRLLPHGCHPPPLRDVHARPTEFVTRCAIDGKFTFIDQRATTVI
GYLPQEILGTSCYEYFHQDDLQLLAEKHRQVLRSKERVETPCYRFKTKPGSYMSLQSQWF
SFINPWTKEVEFIVSLNKVIS
NT seq 1323 nt   +upstreamnt  +downstreamnt
agggaacctcacagccagatcgagaaacggcggcgggataagatgaaccacctgatcgag
gagctgtcggccatgatcccggcctgccagcacatggcccagaagctggacaagctgacc
gtgctgaggaaggccgtgcagcacctgaaagccctcaaaggcactgaaagcggcggcgcc
tttacacacaccacccacaagccttccatcctccccaacgacgaactccggcagctcctg
ctcagggctgcagacggtttcctgttggttgtcagctgcgaccgagcgaagatcctcttc
atctccgagtccgtttccgagatcctcaacttcagcccgttggagctgaccggccagagc
ctctttgatttcatccaccctaaggacatcaccaaggtgaaggaacagctggcgtcgtca
gagctgcacaaccaccgcctcatcgacgctgcaagtgagtcggggcccagagcgtcccgg
agccgccagaccgccgccaatctcacctgtctgtgcgcagccggggttccggtccaggcg
gaggcccccgtcagagcctccgtcctcaccaccggagccaggagagcctttttctgccgg
atgaagcacagtcaggcgatggggaagcgcgacgacaaacaggtgctgcccagcacttct
aagaagaagggtcgttgttgcgccttgtataaccacgaggtccggccggtcaacacgggg
gcgtggttagccgaggcgcggcaatggcgacacctagcggtcagtctgggcaaacgcccc
acagcctggaggaacggtagggaacaaggaaaggtttatagagactcctccagatatcgc
accctccgctgcaccgggtacatgcgcagctggctgagcggccagccggagccggaggcc
gacgccccggacaaggacacgcccgccctcacctgcctggtgatggtgtgccgcctcctg
ccccacggctgccacccgccgccccttagagacgtccacgccaggcccaccgagttcgtg
acgcgctgcgccattgacggcaagttcacgttcatagaccagcgggccacgactgttatc
gggtatttgccgcaggagatcctcggcacgtcgtgctacgagtacttccaccaggacgac
ctgcagctgctggcagagaaacacaggcaagttctccggagcaaggagagagtggagact
ccgtgctaccggttcaaaaccaaacccggctcctacatgtcgctccagagccagtggttc
agcttcatcaacccatggaccaaagaagttgaattcatagtctctttaaacaaggtgatc
tcg

DBGET integrated database retrieval system