KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00005412G001
Entry
GSTEN00005412G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Brite
KEGG Orthology (KO) [BR:tng00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:tng03036]
    GSTEN00005412G001
Chromosome and associated proteins [BR:tng03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    GSTEN00005412G001
SSDB
Motif
Pfam: Ank_2 Ank_4 Ank Ank_3 Ank_5
Other DBs
NCBI-ProteinID: CAF90939
UniProt: Q4T843
Position
undetermined
AA seq 336 aa
QGQSALHVACLCGRLATVGRLLESSQSSINGCDLQGRRPLHMVLSSQSSPNTSLCLRYLL
ERGADVNVKTNSGVTPLHLAASEGLLDCTKTLVQAGADLLARDSVGNTALDAARIGCHRE
VARHLKRYMWQEAKNKELQERKLVQNIYRDLIGQVNMNEGSKKELTNVKIAEWASKKGFP
PIKNFSQAAPGSQYHTQCFPSDGTRWKLKPTTHPLRQQQHPTNKPWTVFTGLHPEKPPLL
PDLRDSVTVRESSSSRQLEYVTKWDSTPHPLPDLPVDVLQRVLFPEAFPSRMASSRHFEP
QGIATVQHRRHPRGPTTSPWTEVAMHLAEALEPGHY
NT seq 1011 nt   +upstreamnt  +downstreamnt
cagggacagtcagctctccacgtcgcctgtctttgcggtcggctcgccaccgttgggcgg
ctgctggagtccagtcagagctccatcaacggctgtgacctccagggccgccggcctctt
cacatggtcctgtcttctcagagttcccccaacacctctttgtgcctcagatacctgcta
gagcgaggggccgacgtcaatgttaaaacaaattccggggtaactcctctgcacttggct
gcctcagaaggcctgctggactgcacgaagaccctcgtccaagctggagcagatctgctg
gcccgggacagcgtgggaaacactgctctggatgcggctcgcattggatgccacagggag
gtggcgaggcacctgaaaaggtacatgtggcaagaagctaagaataaagagttgcaggag
aggaagcttgttcaaaatatatacagagatctgattggacaggtcaacatgaacgaaggc
agcaagaaggaacttactaatgtgaagatagcagagtgggcaagcaagaaaggttttcct
cccattaagaatttctcccaagcggcgccaggaagccagtatcacacccagtgctttcca
tcagatgggaccagatggaaactgaaacctaccacacacccactgcggcagcagcagcat
cccactaacaaaccttggaccgttttcaccggcctccacccagaaaagcccccgttgctg
cccgatctccgggacagcgtcacagtgagggaaagcagcagcagcaggcagctggagtac
gtcacaaagtgggacagtactccccacccgttgcctgacctgcccgtggacgtcctccag
agggtcttgttccctgaagccttcccctccaggatggcctcctcccgccactttgagcca
cagggcatcgcaacggtccagcaccgaagacacccccgggggcccaccacctccccgtgg
actgaggtggctatgcaccttgctgaggcgctggagcctggacactactga

DBGET integrated database retrieval system